Recombinant Human Vesicle transport protein SFT2C (SFT2D3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SFT2D3; Vesicle transport protein SFT2C; SFT2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SFT2D3
Target Protein Sequence
MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAES AAAGLTCLPSVTRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALAL AGSALLRGGAACGRLLRCEEAPSRPALLYMAALGATLFAALGLRSTLLTVLGAGAQVAAL LAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV
Uniprot No.

Target Background

Function
This protein may play a role in the fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.
Database Links

HGNC: 28767

KEGG: hsa:84826

STRING: 9606.ENSP00000310803

UniGene: Hs.345849

Protein Families
SFT2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the cellular function of SFT2C/SFT2D3 in vesicular transport?

SFT2C/SFT2D3 belongs to the SFT2 family of proteins involved in vesicular trafficking pathways. Similar to other vesicular transport proteins, SFT2C likely participates in the regulation of protein trafficking between cellular compartments. Vesicular transport proteins generally function within complex multiprotein systems that mediate cargo recruitment, vesicle budding, transport, tethering, and fusion events. Understanding SFT2C requires consideration of the broader context of vesicular trafficking mechanisms, which include COPI, COPII, and clathrin-coated vesicle pathways that connect organelles such as the endoplasmic reticulum (ER), ER-Golgi intermediate compartment (ERGIC), and Golgi apparatus .

How does SFT2C compare structurally and functionally to other vesicular transport proteins?

While specific structural data for SFT2C is limited, understanding can be derived from comparative analysis with better-characterized vesicular transport proteins. Many vesicular transport proteins share common domains such as membrane-spanning regions and binding sites for interaction with regulatory molecules like GTPases. For example, synaptic vesicle protein 2 (SV2) contains multiple transmembrane domains and nucleotide-binding sites in its cytoplasmic regions . When designing experiments with SFT2C, researchers should consider potential structural motifs that might define its interactions with membranes, cargo molecules, or other trafficking components. The presence of conserved domains can provide insights into interaction networks and functional mechanisms.

What are the key considerations when designing experiments to study SFT2C function?

When designing experiments to investigate SFT2C function, researchers should carefully define their variables and hypotheses. Consider the following approach:

  • Clearly define independent and dependent variables: If investigating SFT2C's role in trafficking, the independent variable might be SFT2C expression levels (wild-type, overexpression, knockdown), while dependent variables could include cargo protein localization, trafficking rates, or cellular phenotypes .

  • Control extraneous variables: Cellular studies of vesicular trafficking are sensitive to many factors including cell type, culture conditions, and expression levels of other trafficking components. Ensure these are standardized across experimental groups .

  • Establish appropriate controls: Include positive controls (known vesicular trafficking proteins) and negative controls (non-trafficking proteins) to validate assay sensitivity and specificity.

  • Develop clear hypotheses: For example, null hypothesis (H0): "SFT2C knockdown does not affect trafficking of protein X between compartments Y and Z" versus alternative hypothesis (H1): "SFT2C knockdown reduces trafficking of protein X between compartments Y and Z" .

What expression systems are optimal for producing recombinant SFT2C for in vitro studies?

The choice of expression system for recombinant SFT2C depends on experimental requirements:

  • Bacterial systems (E. coli): While cost-effective and high-yielding, these may lack appropriate post-translational modifications for a eukaryotic protein like SFT2C.

  • Insect cell systems: Provide more appropriate eukaryotic processing than bacterial systems while maintaining relatively high yields.

  • Mammalian cell systems: Offer the most relevant cellular environment for human SFT2C, ensuring proper folding and modifications, though typically with lower yields.

When selecting an expression system, consider whether native protein conformation or specific post-translational modifications are critical for your research questions. For functional studies examining protein-protein interactions within the vesicular trafficking machinery, mammalian systems may be preferable despite lower yields.

How can high-throughput screening approaches be designed to identify SFT2C interaction partners?

Designing high-throughput screens to identify SFT2C interaction partners requires careful consideration of assay format and data analysis strategies:

  • Two-dimensional screening approaches: Consider implementing two-dimensional screens where SFT2C interactions are assessed against multiple potential partners under varying conditions. The ZetaSuite statistical analysis package can be valuable for analyzing such complex datasets, helping to identify statistically significant interactions while controlling for false discoveries .

  • Bait design considerations: Create tagged versions of SFT2C that preserve protein function. Consider both N- and C-terminal tags to account for possible interference with function, and validate that tagged proteins localize correctly.

  • Validation strategies: High-throughput screens should be followed by orthogonal validation methods such as co-immunoprecipitation, proximity ligation assays, or FRET-based approaches to confirm direct interactions.

  • Data analysis pipeline: Implement robust statistical methods for distinguishing true interactions from background. For two-dimensional screens, apply appropriate normalization methods and statistical tests as outlined in the ZetaSuite methodology .

What approaches can reveal the role of SFT2C in polarized cells with complex trafficking requirements?

Polarized cells present unique vesicular trafficking challenges and specialized approaches:

  • Selection of appropriate cell models: Consider epithelial cell lines (MDCK, Caco-2), neurons, or specialized secretory cells depending on the trafficking pathway of interest.

  • Domain-specific trafficking assays: Design experiments to distinguish between apical, basolateral, axonal, or dendritic trafficking pathways.

  • Live-cell imaging strategies: Implement pulse-chase approaches with photoactivatable or photoconvertible cargo proteins to track trafficking kinetics in real-time.

  • Comparison with known trafficking regulators: In polarized cells, trafficking is regulated by specialized machinery. Compare SFT2C function with known regulators such as AP complexes, dynamins, and cell-type specific GTPases that regulate polarized trafficking .

Does SFT2C interact with nucleotides similar to other vesicular transport proteins?

This question addresses potential regulatory mechanisms of SFT2C function:

While direct evidence for SFT2C nucleotide binding is not provided in the search results, other vesicular transport proteins like SV2A and SV2B bind adenine nucleotides with high affinity . Experimental approaches to investigate potential nucleotide interactions with SFT2C could include:

  • Photoaffinity labeling: Using probes like 8-azido-ATP[γ] biotin to detect direct binding, as was successfully employed with SV2 .

  • Competition assays: Testing whether unlabeled nucleotides compete for binding with labeled probes to determine binding specificity and affinity.

  • Mutational analysis: Creating mutations in potential nucleotide-binding domains and assessing effects on binding and function.

  • Structural analysis: Examining whether SFT2C contains Walker motifs or other nucleotide-binding domains similar to those found in SV2A (positions 129-143 and 266-288) .

If SFT2C does bind nucleotides, this could provide insights into how its function might be regulated by cellular energy status or signaling pathways.

How does SFT2C integrate into the broader vesicular trafficking machinery?

Understanding SFT2C's place in trafficking networks requires examining its interactions with core trafficking components:

  • Coat protein complexes: Investigate potential interactions with COPI, COPII, or clathrin coat components that mediate vesicle formation. The specific coat association would indicate which trafficking pathway(s) SFT2C functions in .

  • Rab GTPases: Determine which Rab family members co-localize or interact with SFT2C. Different Rabs mark specific trafficking pathways (e.g., Rab1 for ER-Golgi, Rab5 for early endosomes) .

  • SNARE proteins: Examine whether SFT2C influences SNARE complex assembly or function, which would suggest a role in vesicle fusion events.

  • Adaptor proteins: Test for interactions with adaptor protein complexes that mediate cargo selection and coat recruitment .

Experimental approaches might include proximity labeling (BioID, APEX), co-immunoprecipitation followed by mass spectrometry, or genetic interaction screens to place SFT2C in specific trafficking pathways.

What disease phenotypes might result from SFT2C dysfunction based on its predicted role in trafficking?

Mutations affecting vesicular trafficking proteins can lead to various disease phenotypes, providing insights into their physiological functions:

  • Potential disease categories: Based on knowledge of other trafficking proteins, SFT2C dysfunction might contribute to neurodegenerative disorders, developmental abnormalities, or metabolic diseases depending on its specific cargo and cellular context .

  • Secretory pathway disruptions: If SFT2C functions in the early secretory pathway like SEC23 components of COPII, its dysfunction might cause ER stress and unfolded protein responses similar to those observed in cranio-lenticulo-sutural dysplasia .

  • Endocytic pathway defects: If SFT2C functions in endocytosis or recycling pathways, its dysfunction might affect receptor signaling, nutrient uptake, or lysosomal function.

  • Tissue-specific manifestations: The phenotypic effects would likely depend on tissue expression patterns and the cargo proteins whose trafficking is most affected by SFT2C dysfunction.

What model systems are most appropriate for studying SFT2C function in vivo?

Selection of appropriate model systems depends on research questions and cellular context:

  • Cell culture models:

    • Simple epithelial cells for basic trafficking studies

    • Polarized epithelial cells for apical/basolateral sorting

    • Neurons for specialized secretory trafficking

    • Patient-derived cells for disease-relevant phenotypes

  • Invertebrate models:

    • C. elegans and Drosophila offer powerful genetic tools and conserved trafficking machinery

    • Transparent organisms allow in vivo visualization of trafficking events

  • Vertebrate models:

    • Zebrafish embryos permit real-time visualization of trafficking in developing tissues

    • Mouse models enable tissue-specific manipulation of SFT2C expression

  • Model selection criteria:

    • Conservation of SFT2C and interaction partners

    • Relevance to the trafficking pathway being studied

    • Availability of genetic tools for manipulation

    • Feasibility of imaging approaches

What are the main technical challenges in purifying functional recombinant SFT2C?

Membrane proteins like SFT2C present specific purification challenges:

  • Solubilization strategies: Testing multiple detergents and conditions to extract SFT2C from membranes while maintaining native conformation. Consider non-ionic detergents (DDM, CHAPS), which often better preserve membrane protein structure.

  • Expression optimization: Determining the optimal expression system, as discussed in question 2.2, with particular attention to membrane protein expression specialists like Pichia pastoris or mammalian inducible systems.

  • Protein stability assessment: Implementing thermal shift assays or limited proteolysis to identify buffer conditions that enhance stability of purified SFT2C.

  • Functional validation: Developing in vitro assays to confirm that purified SFT2C retains biological activity, potentially including liposome binding or reconstitution approaches.

How can researchers address data inconsistencies in SFT2C trafficking studies?

When confronting contradictory results in trafficking studies:

  • Standardize experimental approaches: Ensure consistent methodologies across studies, including cell types, expression levels, tags, and detection methods.

  • Consider contextual factors: Cell-type specific factors may influence SFT2C function, including expression of interaction partners, membrane composition, or cellular polarization state.

  • Control for off-target effects: In knockdown or knockout studies, validate specificity and implement rescue experiments to confirm phenotypes are specifically due to SFT2C loss.

  • Implement multiple complementary techniques: Use orthogonal approaches (biochemical fractionation, imaging, functional assays) to build a consensus view of SFT2C function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.