Recombinant Human Visual pigment-like receptor peropsin (RRH)

Shipped with Ice Packs
In Stock

Description

Sequence Homology

FeaturePeropsin (RRH)Bovine RhodopsinRGR OpsinRetinochrome
Lysine at TM7Present PresentPresentPresent
Counterion ResidueTyrosine GlutamateGlutamateGlutamate
Sequence Identity~40% (vertebrates)N/A~20% (with RRH) ~20% (with RRH)

Data compiled from sequence alignments and structural studies .

Tissue-Specific Distribution

  • Exclusive to the eye: mRNA and protein are restricted to the RPE, absent in retina or nonocular tissues .

  • Subcellular localization:

    • Apical microvilli of RPE cells, adjacent to photoreceptor outer segments .

    • Plasma membrane, confirmed via immunoelectron microscopy .

Expression Patterns

SpeciesTissueSubcellular LocationExpression Level
HumanRPEApical microvilliLow (RPE-specific)
MouseRPEApical microvilliHigh
BovineRPE microsomesApical surfaceModerate

Expression levels inferred from RNA-seq and protein studies .

Proposed Mechanisms

  1. Light Detection:

    • Hypothesis: Peropsin may act as a light receptor, similar to rhodopsin, with photoisomerization triggering G protein signaling.

    • Evidence: Localization in melanin-poor RPE microvilli suggests efficient light absorption .

  2. Retinoid Monitoring:

    • Hypothesis: Peropsin may bind retinal isomers (e.g., all-trans-retinal) released during photoreceptor outer segment phagocytosis.

    • Evidence: Proximity to photoreceptor outer segments and RPE’s role in retinoid recycling .

  3. Enzymatic Activity:

    • Hypothesis: In invertebrates, peropsin acts as a retinal isomerase, converting all-trans-retinal to 11-cis-retinal .

    • Contradiction: Mammalian RRH failed to form pigments with retinal in vitro, casting doubt on this role .

Challenges in Reconstitution

ParameterOutcome in Mammalian RRHOutcome in Invertebrate RRH
Retinal BindingNo pigment formation Forms pigments
PhotoisomerizationNot observed all-trans → 11-cis
Schiff Base HydrolysisN/A (no chromophore)Rapid in invertebrates

Data from HEK293 and Sf9 cell expression systems .

Key Findings

  • Mammalian RRH:

    • No chromophore binding detected with all-trans-retinal or mono-cis isomers .

    • Low expression levels in human and bovine RPE, suggesting a niche role .

  • Invertebrate RRH:

    • Isomerization activity observed, analogous to RGR opsin in mammals .

Comparative Analysis with Other Opsins

FeaturePeropsin (RRH)RGR OpsinRhodopsinRetinochrome
TissueRPERPE + Müller cellsPhotoreceptorsRPE
ChromophoreNot confirmed all-trans-retinal11-cis-retinalall-trans-retinal
FunctionUncertainRetinal isomerizationLight detectionRetinal isomerization
CounterionTyrosine GlutamateGlutamateGlutamate

Adapted from .

Open Questions and Future Directions

  1. Functional Redundancy: Does RRH compensate for RGR in retinoid recycling, or does it serve a distinct role?

  2. Evolutionary Divergence: Why do mammalian and invertebrate peropsins differ in chromophore binding?

  3. Recombinant Limitations: Are expression systems inadequate for capturing native RRH function, or is the protein non-functional in mammals?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RRH; Visual pigment-like receptor peropsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
RRH
Target Protein Sequence
MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI
Uniprot No.

Target Background

Function
Peropsin may play a role in retinal pigment epithelium (RPE) physiology, either by directly detecting light or by monitoring the concentration of retinoids or other photoreceptor-derived compounds.
Gene References Into Functions
  1. In a studied patient cohort, the peropsin gene was not frequently identified as a cause of retinitis pigmentosa or related retinal degenerations. PMID: 17167409
Database Links

HGNC: 10450

OMIM: 605224

KEGG: hsa:10692

STRING: 9606.ENSP00000314992

UniGene: Hs.658310

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Found only in the eye, where it is localized to the retinal pigment epithelium (RPE). In the RPE, it is localized to the microvilli that surround the photoreceptor outer segments.

Q&A

What is peropsin and where is it localized in the human eye?

Peropsin (RRH) is a visual pigment-like protein that belongs to the G protein-coupled receptor family. It was first identified through cDNA sequencing of human ocular tissues . Expression studies have demonstrated that peropsin mRNA is found exclusively in the eye, specifically localized to the retinal pigment epithelium (RPE) .

Immunofluorescent and immunoperoxidase staining with affinity-purified anti-peropsin antibodies have revealed that the protein is localized to the apical face of the RPE . Confocal microscopy studies show the immunofluorescent anti-peropsin signal within numerous microvilli projecting from the apical surface of the RPE, where it is in close proximity to photoreceptor outer segments . This specific localization suggests that peropsin may play a role in the communication between RPE cells and photoreceptors.

Unlike RGR opsin, which is found in internal membranes of RPE cells, peropsin is distinctly localized to the cell surface, specifically to the apical microvilli . This positioning allows efficient light absorption even in the presence of high concentrations of RPE melanin, as most melanosomes are sequestered within the RPE cell bodies.

What structural characteristics define peropsin as a visual pigment-like protein?

Peropsin exhibits key structural features that classify it as a member of the visual pigment family. The deduced amino acid sequences of human and mouse peropsin show the hallmarks of typical G protein-coupled receptors, including:

  • Seven segments of hydrophobic amino acids that presumably correspond to membrane-spanning α-helices

  • A (glu/asp)-arg-tyr triplet at the beginning of the second cytosolic loop

  • Multiple serine and threonine residues in the carboxyl-terminal tail (five in human, two in mouse) that are potential sites for regulation by receptor kinases

  • A potential site for asn-linked glycosylation within the first 10 residues of both human and mouse peropsin

Most significantly, peropsin contains a lysine at a position corresponding to Lys-296 in bovine rhodopsin, which is the site of covalent attachment of the 11-cis retinal chromophore via a Schiff base . This conservation suggests that peropsin likely binds to a retinoid ligand through a similar mechanism.

Blast analysis reveals that peropsin shares highest homology with vertebrate and invertebrate visual pigments, rather than with other G protein-coupled receptors . While peropsin also shows significant homology to bovine RGR and squid retinochrome, the blast alignment indicates that the similarity between peropsin and the majority of visual pigments is greater than that between peropsin and RGR or retinochrome .

What are the proposed functional roles of peropsin in retinal biology?

Based on peropsin's structural homology to visual pigments and its strategic localization in the RPE, researchers have proposed two distinct potential modes of action :

  • Light receptor function: Peropsin may function as a light receptor that signals in response to photoisomerization of a bound chromophore . Its location in the apical microvilli would allow for efficient light absorption despite the presence of RPE melanin.

  • Retinoid sensor function: Alternatively, peropsin could be activated (or inactivated) by binding to one or more retinal isomers in a reaction that does not depend on illumination . This would suggest a role in monitoring the concentration of retinoids or other photoreceptor-derived compounds.

The intimate association between RPE microvilli and photoreceptor outer segments is known to be important for several processes, including adhesion of the retina to the RPE, transport of small molecules between the RPE and photoreceptors, and phagocytosis of photoreceptor outer segments . Peropsin's localization to the microvilli suggests it may play a role in regulating these RPE physiological functions via G protein-coupled receptor signaling pathways.

How does peropsin compare evolutionarily to other opsins across diverse species?

Evolutionary analysis of peropsin provides important insights into its conservation and potential functional significance. The human and mouse peropsin orthologs share 80% amino acid identity, with the regions of greatest divergence occurring in the amino- and carboxyl-terminal tails . This high level of conservation suggests functional importance.

Studies in bivalve mollusks demonstrate the evolutionary diversity of opsins, with larvae expressing multiple opsin types . While these studies don't specifically address peropsin homologs, they show that opsin expression patterns can be species-specific across development . In some cases, certain opsin paralogs have been co-opted for new visual processes in adult structures, suggesting evolutionary adaptations of these genes .

The presence of opsin genes across diverse animal phyla and their expression in both larval and adult stages underscores their fundamental importance in light detection and visual processes throughout evolution . Peropsin's selective conservation in vertebrate RPE suggests it serves an important specialized function that has been maintained throughout vertebrate evolution.

What methodological approaches can distinguish between peropsin's potential roles as a light receptor versus a retinoid sensor?

Determining whether peropsin functions primarily as a light receptor or a retinoid sensor requires multiple complementary experimental approaches:

  • Spectroscopic analysis:

    • Purify recombinant peropsin and reconstitute with various retinal isomers

    • Record absorption spectra before and after light exposure

    • Determine if peropsin undergoes photoisomerization similar to rhodopsin or exhibits properties more similar to RGR

  • Signaling pathway identification:

    • Express peropsin in cell culture systems with various reporter constructs

    • Expose cells to light stimulation protocols and/or retinoid treatments

    • Monitor activation of potential downstream effectors (G proteins, arrestins)

    • Compare signaling properties with known visual pigments and non-visual opsins

  • Structural biology approaches:

    • Determine the three-dimensional structure of peropsin in different states

    • Compare conformational changes induced by light versus those induced by retinoid binding alone

    • Identify potential intramolecular interactions that stabilize active versus inactive states

  • In vivo physiological studies:

    • Generate peropsin knockout/knockdown models

    • Assess effects on RPE physiology, including phagocytosis rhythms, retinoid metabolism, and electrical properties

    • Measure responses to light versus responses to changes in retinoid concentrations

  • Mutagenesis studies:

    • Create targeted mutations in the putative chromophore binding site

    • Generate mutations in potential G protein interaction domains

    • Assess functional consequences of these mutations on both light responsiveness and retinoid sensitivity

These approaches would help determine whether peropsin functions primarily in light detection, retinoid sensing, or potentially in both capacities under different physiological conditions .

What are the challenges in studying potential interactions between peropsin and photoreceptor-derived compounds?

Investigating interactions between peropsin and photoreceptor-derived compounds presents several methodological challenges:

  • Identifying physiologically relevant ligands:

    • The interphotoreceptor matrix contains numerous potential candidates including retinoids, fatty acids, and signaling molecules

    • Screening approaches must account for compounds with potentially low binding affinities

    • The dynamic nature of the interphotoreceptor space during light/dark cycles complicates sampling

  • Establishing appropriate experimental systems:

    • Isolated RPE cells may not maintain the appropriate polarization for peropsin localization

    • Co-culture systems with photoreceptors are technically challenging but may better recapitulate the natural environment

    • In vivo approaches require careful microdissection and sampling techniques

  • Detection of subtle physiological responses:

    • Changes in RPE physiology may be small or occur over extended timeframes

    • Baseline variability in primary RPE cultures can mask subtle effects

    • Separating direct peropsin-mediated effects from indirect pathways requires careful controls

  • Technical considerations for binding studies:

    • Hydrophobic nature of many potential ligands complicates binding assays

    • Maintaining properly folded peropsin in vitro requires specialized techniques

    • Distinguishing specific from non-specific binding requires rigorous controls

  • Temporal aspects of potential interactions:

    • Photoreceptor-derived compound concentrations may vary with circadian rhythms

    • Interactions might be light-dependent or show diurnal patterns

    • Experimental designs must account for these temporal considerations

Addressing these challenges requires interdisciplinary approaches combining biochemical, cell biological, and physiological methods to comprehensively characterize peropsin's interactions with photoreceptor-derived compounds .

What expression systems are optimal for producing functional recombinant peropsin?

The choice of expression system for recombinant peropsin production depends on the specific research objectives. Each system offers distinct advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
Mammalian cells (HEK293, COS-7)Native post-translational modifications; Proper folding of GPCRs; Compatible with functional assaysLower protein yield; Higher cost; Slower growthUse inducible promoters; Supplement with 9-cis or all-trans retinal; Optimize transfection protocols
Insect cells (Sf9, Hi5)Higher protein yield than mammalian cells; Post-translational modifications; ScalableMore expensive than microbial systems; Complex media requirementsOptimize baculovirus MOI; Include lipids in culture media; Harvest at optimal timepoints
Yeast (Pichia pastoris)Cost-effective; High cell density; Eukaryotic processingMay not produce properly folded GPCRs; Glycosylation differs from mammalsUse low induction temperatures; Include membrane-inducing agents; Screen multiple clones
E. coliHighest yield; Lowest cost; Rapid productionOften produces inclusion bodies; No post-translational modificationsExpress as fusion proteins; Use specialized strains; Refold from inclusion bodies

For structural studies, mammalian or insect cell systems typically produce the most properly folded protein. If the goal is to study ligand binding, expression in the presence of retinal or retinal analogs may improve functional yield. For functional studies, mammalian expression systems that maintain the proper cellular machinery for GPCR signaling are preferable.

When expressing peropsin, researchers should consider including the following elements in their constructs:

  • Affinity tags for purification (His, FLAG)

  • Fluorescent fusion partners for localization studies

  • Cleavable tags that can be removed after purification

  • Signal sequences to ensure proper membrane targeting

The choice of detergent for solubilization and purification is also critical, with mild detergents like DDM, LMNG, or GDN generally being most suitable for maintaining GPCR function .

What immunological methods are most effective for detecting peropsin in tissue samples?

Detecting peropsin in tissue samples requires careful selection of antibodies and optimization of protocols. Based on published approaches and general principles for detecting membrane proteins:

  • Antibody selection criteria:

    • Target species-specific regions of peropsin to avoid cross-reactivity

    • C-terminal epitopes have been successfully used for peropsin detection

    • Validate specificity using positive controls (RPE tissue) and negative controls (tissues without peropsin expression)

  • Western blot protocol optimization:

    • Sample preparation: Use RIPA or similar buffers with protease inhibitors

    • Recommended dilutions: 1:500-1:2000 for primary anti-peropsin antibodies

    • Expected molecular weight: Approximately 37-38 kDa for unglycosylated peropsin

    • Membrane transfer: Extended transfer times for hydrophobic membrane proteins

    • Detection: More sensitive methods (chemiluminescence) may be required for low abundance proteins

  • Immunohistochemistry considerations:

    • Fixation: 4% paraformaldehyde has been successfully used for peropsin detection

    • Permeabilization: Gentle detergents (0.1-0.3% Triton X-100) to preserve membrane structures

    • Blocking: BSA or serum from secondary antibody host species

    • Antigen retrieval: May improve detection, especially in fixed tissues

    • Counterstaining: Use markers for RPE (RPE65) and apical membranes to confirm localization

  • Multiplexed detection approaches:

    • Double immunofluorescence with markers for RPE and photoreceptors

    • Combine with phalloidin staining to visualize the actin cytoskeleton in microvilli

    • Co-localization studies with other membrane proteins

  • Advanced visualization techniques:

    • Confocal microscopy for high-resolution localization studies

    • Super-resolution microscopy for detailed analysis of microvilli distribution

    • Immuno-electron microscopy for ultrastructural localization

These methodological considerations should be tailored to the specific research question and sample type being investigated .

What are the most appropriate cell and tissue models for studying peropsin function?

Selecting appropriate experimental models is crucial for investigating peropsin's physiological roles. The following models offer distinct advantages for peropsin research:

  • Primary RPE cell cultures:

    • Most physiologically relevant system

    • Isolation protocol: Careful dissection of eye cups, enzymatic digestion, and selective plating

    • Culture conditions: Medium containing retinoids and growth factors on permeable supports

    • Advantages: Express native levels of peropsin; maintain polarized distribution

    • Limitations: Limited proliferation capacity; donor variability; challenging to manipulate genetically

  • Established RPE cell lines:

    • ARPE-19 (human): Forms polarized monolayers; widely used

    • RPE-J (rat): Temperature-sensitive SV40 T antigen; forms functional tight junctions

    • D407 (human): Rapidly proliferating; easier to transfect

    • Advantages: Consistent source; amenable to genetic modification; unlimited supply

    • Limitations: May not express all RPE-specific genes; variable polarization

  • Organoids and 3D culture systems:

    • iPSC-derived RPE organoids: Recapitulate developmental processes

    • RPE spheroids: Self-organizing 3D structures

    • Advantages: Better mimic tissue architecture; allow for long-term studies

    • Limitations: Technical complexity; variability between preparations

  • In vivo models:

    • Mouse models: Genetic tractability; mammalian physiology

    • Zebrafish: Rapid development; amenable to live imaging

    • Advantages: Intact RPE-photoreceptor interface; physiological light exposure

    • Limitations: Species differences; complex interactions

  • Ex vivo preparations:

    • RPE-choroid explants: Maintain tissue architecture

    • Eyecup preparations: Preserve RPE-retina interactions

    • Advantages: Intact tissue organization; short-term physiological studies

    • Limitations: Limited viability; difficult to manipulate experimentally

When selecting a model system, researchers should consider factors such as species relevance, maintenance of polarized peropsin distribution, presence of photoreceptor interactions, and compatibility with desired experimental techniques. For functional studies, models that maintain the apical-basal polarity of RPE cells are particularly important given peropsin's specific localization to apical microvilli .

What genome editing approaches can be used to interrogate peropsin function?

Genome editing technologies offer powerful tools for investigating peropsin's physiological roles. The following approaches can be applied to study peropsin function:

  • CRISPR/Cas9-mediated knockout strategies:

    • Design guide RNAs targeting early exons of the RRH gene

    • Generate complete knockouts for loss-of-function studies

    • Create conditional knockouts using loxP/Cre systems for temporal control

    • Verify knockouts using genomic PCR, RT-PCR, and western blotting

  • Precision editing approaches:

    • Introduce point mutations in key functional domains:

      • Mutate the retinal-binding lysine to assess chromophore dependence

      • Modify the (glu/asp)-arg-tyr motif to disrupt G protein coupling

      • Alter potential phosphorylation sites in the C-terminal tail

    • Create tagged versions for localization and interaction studies

    • Generate reporter knock-ins to monitor expression patterns

  • Appropriate cell models for genome editing:

    • iPSC-derived RPE cells: Generate edited iPSCs, then differentiate to RPE

    • ARPE-19 or other RPE cell lines: Direct editing in established lines

    • Primary RPE cells: More challenging but possible with high-efficiency systems

    • Animal models: Create germline modifications for in vivo studies

  • Phenotypic analysis of edited cells:

    • Morphological assessment: Microvilli formation, polarization

    • Functional assays: Phagocytosis activity, retinoid processing

    • Gene expression analysis: RNA-seq to identify affected pathways

    • Protein interaction studies: Identify binding partners altered by editing

  • Rescue experiments:

    • Reintroduce wild-type or mutant peropsin to knockout models

    • Use inducible expression systems for temporal control

    • Compare different species orthologs to identify conserved functions

These genome editing approaches, combined with appropriate functional assays, provide powerful tools for dissecting peropsin's roles in RPE physiology .

What are the key characteristics of peropsin compared to other visual pigment family members?

The following table summarizes the distinctive characteristics of peropsin compared to other members of the visual pigment family:

CharacteristicClassical Visual PigmentsPeropsinRGR/Retinochrome
Expression LocationPhotoreceptor cellsRPE, specifically apical microvilliRPE and Müller cells, internal membranes
Subcellular LocalizationDisc/plasma membraneCell surface membraneIntracellular membranes
Sequence HomologyReference groupMore similar to visual pigments than to RGR/retinochromeHighly divergent branch
Chromophore Binding11-cis retinalUnknown, likely retinal isomerAll-trans retinal
Light Response11-cis → all-trans isomerizationUnknownPossible all-trans → 11-cis isomerization
Signaling PartnersG proteins (transducin)UnknownUnknown
Proposed FunctionPhototransductionLight receptor or retinoid sensorPotential retinal isomerase
Distinctive FeaturesSpecialized for light detectionApical microvilli localizationInternal membrane localization

This comparative analysis highlights peropsin's unique characteristics as a visual pigment-like protein with distinctive localization and potentially specialized functions in RPE physiology .

What are common technical challenges when working with peropsin and how can they be addressed?

Working with peropsin presents several technical challenges that researchers should anticipate and address:

  • Expression and purification challenges:

    • Challenge: Low expression levels and protein instability

    • Solutions:

      • Use codon-optimized constructs

      • Include stabilizing fusion partners

      • Express at lower temperatures (28-30°C)

      • Include retinoids during expression and purification

      • Screen multiple detergents for optimal stability

  • Antibody specificity issues:

    • Challenge: Cross-reactivity with other opsins or non-specific binding

    • Solutions:

      • Validate antibodies with appropriate positive and negative controls

      • Use knockout/knockdown samples as negative controls

      • Perform peptide competition assays to confirm specificity

      • Consider raising antibodies against unique regions of peropsin

  • Localization detection difficulties:

    • Challenge: Preserving microvilli structure during fixation

    • Solutions:

      • Use gentle fixation protocols (2-4% PFA, short duration)

      • Optimize permeabilization to preserve membrane structures

      • Use apical membrane markers as co-localization controls

      • Apply super-resolution microscopy for detailed visualization

  • Functional assay limitations:

    • Challenge: Unknown signaling pathways and functional readouts

    • Solutions:

      • Screen multiple potential G protein partners

      • Use broad second messenger assays (cAMP, Ca²⁺, IP₃)

      • Develop reporter systems based on predicted signaling pathways

      • Combine with physiological assays of RPE function

  • Retinoid handling complications:

    • Challenge: Light sensitivity and oxidation of retinoids

    • Solutions:

      • Work under dim red light conditions

      • Include antioxidants in buffers

      • Prepare fresh retinoid solutions

      • Verify retinoid isomer purity by HPLC

By anticipating these challenges and implementing appropriate technical strategies, researchers can enhance the success of their studies on peropsin structure, localization, and function .

What are the most promising approaches for elucidating peropsin's potential role in retinal diseases?

Understanding peropsin's potential involvement in retinal diseases requires multi-faceted research approaches:

  • Expression profiling in disease states:

    • Analyze peropsin expression in RPE from donors with various retinal diseases

    • Examine expression changes in RPE cells exposed to disease-relevant stressors

    • Use single-cell RNA-seq to identify cell-specific alterations in peropsin expression

  • Genetic association studies:

    • Sequence the RRH gene in patients with RPE-related retinal diseases

    • Analyze existing genome-wide association study (GWAS) data for RRH variants

    • Evaluate the functional consequences of identified variants using in vitro assays

  • Animal model investigations:

    • Generate peropsin knockout or mutant animal models

    • Assess retinal structure and function throughout aging

    • Challenge these models with light damage, oxidative stress, or other disease-relevant insults

    • Evaluate RPE-specific functions including phagocytosis and retinoid cycling

  • Therapeutic target assessment:

    • Identify compounds that modulate peropsin activity

    • Test protective effects of peropsin modulators in disease models

    • Develop targeted delivery systems for RPE-specific interventions

  • Integration with known disease mechanisms:

    • Investigate interactions between peropsin and known disease-associated proteins

    • Examine peropsin's role in RPE responses to oxidative stress and inflammation

    • Evaluate age-related changes in peropsin expression and localization

These approaches would help determine whether peropsin dysfunction contributes to retinal disease pathogenesis and whether targeting peropsin might offer therapeutic benefits for conditions affecting the RPE-photoreceptor interface .

What essential characteristics of recombinant human peropsin should researchers verify?

When working with recombinant human visual pigment-like receptor peropsin, researchers should verify the following essential characteristics:

CharacteristicVerification MethodExpected Result
Molecular WeightSDS-PAGE/Western blot~37 kDa (unglycosylated)
~38-45 kDa (glycosylated, depending on expression system)
Antibody ReactivityWestern blotSingle specific band at expected molecular weight
ImmunofluorescenceSignal at apical surface of RPE cells
Retinal BindingSpectroscopic analysisCharacteristic absorption spectrum
Shift in spectrum upon light exposureIf functioning as a photopigment
Subcellular LocalizationImmunofluorescence in transfected cellsPlasma membrane localization
Co-localization with membrane markersPresent in apical domain if polarized cells used
Post-translational ModificationsMass spectrometryIdentification of glycosylation sites
Phosphorylation analysisDetection of phosphorylated residues
Functional ActivityG protein coupling assaysIdentification of signaling partners
Ligand binding studiesDetermination of retinoid binding properties
Structural IntegrityCircular dichroismConfirmation of alpha-helical structure
Thermal stability assaysAssessment of protein stability

Verifying these characteristics ensures that the recombinant peropsin maintains native-like properties that are essential for meaningful functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.