Recombinant Human Vitamin K epoxide reductase complex subunit 1-like protein 1 (VKORC1L1)

Shipped with Ice Packs
In Stock

Description

Vitamin K Recycling

VKORC1L1 reduces vitamin K 2,3-epoxide (vitamin K>O) to its active hydroquinone form (vitamin KH2), enabling γ-carboxylation of proteins. Unlike VKORC1, it contributes minimally to hepatic coagulation factor synthesis but supports carboxylation in extrahepatic tissues (e.g., bone, vasculature) .

Antioxidant Properties

VKORC1L1 mitigates oxidative stress by:

  • Generating vitamin KH2, a potent radical scavenger .

  • Regulating reactive oxygen species (ROS) levels in vascular smooth muscle cells (VSMCs). Knockdown experiments show increased superoxide (O2\text{O}_2^-) and hydrogen peroxide (H2O2\text{H}_2\text{O}_2) production in VSMCs .

Modulation of ER Stress and Inflammation

VKORC1L1 downregulation activates:

  • Unfolded Protein Response (UPR): Upregulates GRP78, a marker of ER stress .

  • NF-κB/IL-6 Pathway: Enhances pro-inflammatory cytokine expression, linking oxidative stress to vascular inflammation .

Comparative Analysis of VKORC1 and VKORC1L1

FeatureVKORC1VKORC1L1
Primary RoleCoagulation factor synthesisAntioxidant defense, tissue γ-carboxylation
Warfarin SensitivityHigh (IC50\text{IC}_{50}: 0.2 μM)Low (IC50\text{IC}_{50}: 10 μM)
Tissue ExpressionLiver-dominantUbiquitous (lung, brain, testes)
Contribution to VKOR Activity99% in liver<1% in liver, significant in extrahepatic tissues

Enzymatic Activity Assays

  • Expression Systems: Recombinant VKORC1L1 has been expressed in Pichia pastoris and HEK293T cells, showing 50-fold lower catalytic efficiency than VKORC1 .

  • Substrate Specificity: Preferentially reduces vitamin K>O over vitamin K quinone .

Pharmacological Inhibition

  • Anticoagulant Resistance: VKORC1L1 is less sensitive to 4-hydroxycoumarins (e.g., warfarin) but equally inhibited by rodenticides (e.g., brodifacoum) .

  • Therapeutic Implications: Warfarin-induced vascular dysfunction may involve VKORC1L1 suppression, exacerbating oxidative stress and neointima formation .

Therapeutic Potential and Future Directions

  • Vitamin K Supplementation: Menaquinone-7 (MK7) attenuates VKORC1L1 deficiency effects, reducing vascular inflammation and ER stress in VSMCs .

  • Gene Therapy: Targeting VKORC1L1 expression could mitigate warfarin-associated vascular complications.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VKORC1L1; Vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VKORC1L1
Target Protein Sequence
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMS VVGSLYLAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD
Uniprot No.

Target Background

Function
VKORC1L1 plays a crucial role in vitamin K metabolism. It can reduce inactive vitamin K 2,3-epoxide to active vitamin K (in vitro), potentially contributing to vitamin K-mediated protection against oxidative stress. It is involved in vitamin K-dependent gamma-carboxylation of Glu residues in target proteins.
Gene References Into Functions
  1. This study indicates that polymorphisms in EPHX1 and VKORC1L1 could be key factors in determining stable warfarin doses. PMID: 29054760
  2. A coordinated action of the four conserved cysteines of VKORC1L1 is essential for active site regeneration. PMID: 24532791
  3. VKORC1L1 is responsible for driving vitamin K-mediated intracellular antioxidation pathways crucial for cell survival. PMID: 21367861
  4. VKORC1L1 does not influence the variability of warfarin dose requirement in a Japanese patient population. PMID: 17996924
Database Links

HGNC: 21492

OMIM: 608838

KEGG: hsa:154807

STRING: 9606.ENSP00000353998

UniGene: Hs.427232

Protein Families
VKOR family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of VKORC1L1 and how does it differ from VKORC1?

VKORC1L1 is a four-transmembrane domain protein with both N and C termini located in the cytoplasm, as revealed by fluorescence protease protection (FPP) assays . This topology differs significantly from VKORC1, suggesting different functional properties. The distinct membrane organization of VKORC1L1 contributes to its unique substrate interactions and reaction mechanisms .

When studying the membrane topology of VKORC1L1:

  • Use GFP fusion proteins at N- or C-termini for FPP assays

  • Confirm that fusion proteins retain enzymatic activity (typically 50-70% of wild-type activity)

  • Compare with established VKORC1 topology as a reference point

  • Consider using domain exchange experiments between VKORC1L1 and VKORC1 to identify structure-function relationships

What is the functional role of conserved cysteine residues in VKORC1L1?

The conserved cysteine residues in VKORC1L1 are essential for its active site regeneration through an intra-molecular electron transfer pathway . Unlike VKORC1, VKORC1L1 employs a concerted action of four conserved cysteines:

  • The active site contains a CXXC motif (including Cys-139) that directly reduces vitamin K

  • The second loop cysteine (Cys-58) attacks the active site disulfide, forming an intermediate disulfide with Cys-139

  • The first loop cysteine (Cys-50) attacks this intermediate disulfide, resulting in active site reduction

This mechanism has been confirmed through intermediate disulfide trapping experiments. Mutation of these conserved cysteines severely impairs VKORC1L1's enzymatic function, highlighting their critical importance in the reaction mechanism .

Experimental Methodologies

Several expression systems have been successfully used for VKORC1L1:

  • Yeast expression system:

    • Optimize VKORC1L1 coding sequences for heterologous expression in Pichia pastoris

    • Subclone into vectors like pPICZ-B with appropriate tags (e.g., c-myc)

    • Include flexible linkers (e.g., (GGS)3) between the protein and tag

  • Mammalian cell expression:

    • Express in HEK293 cells with epitope tags for detection and purification

    • GFP fusions retain 50-70% activity compared to wild-type enzyme

    • Confirm proper folding and ER quality control

  • Wheat germ cell-free expression:

    • Suitable for producing full-length protein for structural studies

    • Allows expression of potentially toxic membrane proteins

After expression, confirm functionality through activity assays measuring vitamin K epoxide reduction or vitamin K hydroquinone generation. Western blotting with anti-tag antibodies (e.g., anti-c-myc) can quantify expression levels relative to known standards .

How does VKORC1L1 contribute to vitamin K-dependent carboxylation in vivo?

VKORC1L1 contributes to vitamin K-dependent carboxylation primarily during pre- and perinatal development. Studies with knockout mice have provided crucial insights:

  • VKORC1-/- mice survive longer (1 week) than GGCX-/- mice (which die during midembryogenesis or at birth), suggesting that VKORC1L1 can partially compensate for VKORC1 loss

  • VKORC1-/-;VKORC1L1+/- mice die at birth with severe hemorrhaging, indicating that VKORC1L1 supports carboxylation during pre- and perinatal periods

  • VKORC1L1 levels in liver are typically insufficient for supporting carboxylation beyond postnatal day 7

Quantitative measurements have shown that VKORC1-/-;VKORC1L1+/+ P0 livers have only 0.4% VKOR activity compared to wild-type livers . Despite this low activity, it is functionally significant during early development.

Overexpression experiments provide further evidence for VKORC1L1's contribution:

  • Transgenic expression of VKORC1L1 in liver using APOE regulatory sequences can rescue carboxylation and hemostasis in adult VKORC1-/- mice

  • Even when VKORC1L1-FLAG protein reached only ~4% of endogenous VKORC1 levels, it was sufficient to rescue the lethal phenotype

What is VKORC1L1's role in ferroptosis and tumor suppression?

Recent research has identified VKORC1L1 as a potent ferroptosis repressor with implications for tumor suppression:

  • Ferroptosis protection mechanism:

    • VKORC1L1 generates vitamin K hydroquinone, a potent radical trapping antioxidant

    • This counteracts phospholipid peroxides independently of the canonical GSH/GPX4 mechanism

    • CRISPR-Cas9 knockout of VKORC1L1 increases cellular sensitivity to ferroptosis inducers

  • Regulation by p53:

    • VKORC1L1 is a direct transcriptional target of p53

    • Activation of p53 induces downregulation of VKORC1L1 expression

    • This downregulation sensitizes cells to ferroptosis as part of p53's tumor suppression function

  • Potential therapeutic implications:

    • Warfarin, a VKORC1L1 inhibitor, represses tumor growth by promoting ferroptosis in mouse models

    • VKORC1L1 inhibition represents a potential therapeutic approach for cancer treatment

This newly discovered role connects vitamin K metabolism with major tumor suppression pathways and suggests that VKORC1L1 may have evolved to protect cells from oxidative damage rather than primarily supporting vitamin K-dependent carboxylation.

Does VKORC1L1 function in extrahepatic tissues during anticoagulation therapy?

VKORC1L1 plays a significant role in extrahepatic tissues during anticoagulation therapy with vitamin K antagonists (VKAs):

  • VKORC1L1 is not as effectively inhibited by VKAs as VKORC1, allowing continued vitamin K reduction in tissues during anticoagulation

  • Characterization of VKOR activity in various tissues demonstrated that a portion of this activity is supported by VKORC1L1, particularly in testis, lung, and osteoblasts

  • VKORC1L1 mRNA levels are higher than VKORC1 in some tissues such as brain and testes

This tissue-specific function helps explain the limited unwanted side effects of VKAs and why vitamin K-dependent proteins produced by extrahepatic tissues (e.g., matrix Gla protein, osteocalcin) remain partially functional during anticoagulation therapy . The differential expression and inhibition patterns suggest that VKORC1L1 may have evolved specific roles in extrahepatic vitamin K metabolism.

What is the molecular mechanism of VKORC1L1-mediated vitamin K reduction?

The molecular mechanism of VKORC1L1-mediated vitamin K reduction involves a unique intra-molecular electron transfer pathway that distinguishes it from VKORC1:

This distinct mechanism may explain VKORC1L1's differential sensitivity to inhibitors and its potentially specialized physiological functions compared to VKORC1.

How efficient is VKORC1L1 in supporting vitamin K-dependent carboxylation compared to VKORC1?

The efficiency of VKORC1L1 in supporting vitamin K-dependent carboxylation compared to VKORC1 remains a subject of debate in the literature:

ContextVKORC1L1 vs. VKORC1 EfficiencyReference
Cell-based assaysSimilar efficiency in supporting carboxylation
Mouse liver (P0)0.4% of wild-type VKOR activity
In vitro (Westhofen et al.)18,054-fold slower reduction of vitamin K epoxide
Overexpression in VKORC1-/- liverRescues carboxylation when expressed at ~4% of normal VKORC1 levels
Extrahepatic tissuesMore significant contribution, especially in testis, lung, osteoblasts

The contradictions in these findings can be attributed to methodological differences:

  • Some comparisons were between VKORC1L1 in crude cell lysates versus purified VKORC1

  • Different experimental systems and conditions were used across studies

  • Tissue-specific factors may influence relative efficiency

The consensus emerging from multiple studies suggests that while VKORC1L1 can efficiently support vitamin K-dependent carboxylation in vitro and when overexpressed, its physiological contribution is limited by its relatively low expression levels in liver under normal conditions.

What are the 3D structural features of VKORC1L1 and how do they relate to function?

While a high-resolution 3D structure of human VKORC1L1 has not yet been determined, computational modeling and experimental approaches have provided insights into its structure-function relationships:

  • Membrane topology:

    • Four transmembrane domains with both N and C termini in the cytoplasm

    • Differs from VKORC1, suggesting unique structural organization

  • Active site configuration:

    • CXXC motif at the periplasmic edge of the fourth transmembrane segment

    • Requires specific orientation of TM segments for enzymatic activity

  • Loop structure:

    • Conserved cysteines in the loop between TM1 and TM2 are critical for function

    • Loop positioning facilitates the intra-molecular electron transfer pathway

  • Functional states:

    • Like VKORC1, VKORC1L1 likely requires conformational reorganization for activity

    • Multiple redox states are generated during its catalytic cycle

    • Computational approaches can help identify these transient states

By integrating findings from bacterial VKOR homologs, mutagenesis studies, and computational modeling, researchers are building a clearer picture of VKORC1L1's structure-function relationships. Further structural studies using techniques like cryo-EM may provide more definitive insights.

Is VKORC1L1 primarily involved in vitamin K cycle or antioxidation pathways?

The physiological role of VKORC1L1 remains debated, with evidence supporting both vitamin K cycle and antioxidation functions:

Evidence for vitamin K cycle involvement:

  • Efficiently supports vitamin K-dependent carboxylation in cell-based assays

  • Contributes to carboxylation during pre- and perinatal periods in VKORC1-deficient mice

  • When overexpressed in liver, rescues carboxylation and hemostasis in VKORC1-/- mice

Evidence for antioxidation pathway role:

  • Particularly efficient at generating vitamin K hydroquinone, a potent radical trapping antioxidant

  • Identified as a critical ferroptosis suppressor, protecting cells from lipid peroxidation

  • Counteracts phospholipid peroxides independent of the canonical GSH/GPX4 mechanism

  • Regulated by p53 as part of tumor suppression mechanisms

The current consensus suggests that while VKORC1L1 can participate in the vitamin K cycle, its unique properties make it particularly suited for an antioxidant role. The fact that VKORC1-/- mice die from hemorrhaging despite having VKORC1L1 indicates that its contribution to the vitamin K cycle in liver is secondary to VKORC1 under normal physiological conditions .

Future research should further clarify the relative importance of these functions in different physiological and pathological contexts.

What are the implications of VKORC1L1 research for therapeutic development?

Research on VKORC1L1 has several important implications for therapeutic development:

  • Anticoagulation therapy:

    • VKORC1L1 is less sensitive to vitamin K antagonists than VKORC1

    • Developing VKORC1-specific inhibitors might achieve anticoagulation with fewer side effects

    • Understanding tissue-specific roles could lead to more targeted interventions

  • Cancer treatment:

    • VKORC1L1 inhibition promotes ferroptosis and suppresses tumor growth

    • Warfarin, an FDA-approved anticoagulant that inhibits VKORC1L1, has shown anti-tumor effects

    • Specific VKORC1L1 inhibitors might provide new cancer treatment approaches

    • Combination therapies targeting VKORC1L1 and other ferroptosis regulators could enhance efficacy

  • Developmental disorders:

    • VKORC1L1's role in pre- and perinatal development suggests potential implications for congenital bleeding disorders

    • Understanding its contribution could improve management of vitamin K deficiency in newborns

  • Extrahepatic vitamin K metabolism:

    • VKORC1L1's importance in tissues like bone, vasculature, and brain suggests therapeutic opportunities

    • Could target specific vitamin K-dependent processes without affecting coagulation

Future studies should evaluate the pharmaco-toxicologic effects of specific VKORC1L1 inhibitors and explore the therapeutic potential of modulating VKORC1L1 activity in various disease contexts .

What research gaps remain in understanding VKORC1L1 function?

Despite significant advances, several important questions about VKORC1L1 remain unanswered:

  • High-resolution structure:

    • No crystal or cryo-EM structure of VKORC1L1 has been reported

    • Structural details would enhance understanding of its unique mechanism and facilitate drug design

  • Natural variants and polymorphisms:

    • Limited information on natural VKORC1L1 variants in humans

    • Unknown whether polymorphisms affect disease susceptibility or drug responses

  • Tissue-specific roles:

    • Comprehensive characterization of VKORC1L1 function across different tissues is needed

    • Particular importance in brain and testes where VKORC1L1 expression exceeds VKORC1

  • Redox partners:

    • Identity of proteins that provide electrons for VKORC1L1 regeneration remains unclear

    • May differ from redox partners of VKORC1

  • Developmental regulation:

    • Mechanisms controlling VKORC1L1 expression during development are poorly understood

    • How its function complements VKORC1 during different developmental stages

  • Interaction with vitamin K-dependent proteins:

    • Whether VKORC1L1 preferentially supports carboxylation of specific vitamin K-dependent proteins

    • Potential direct interactions with substrate proteins

Addressing these gaps will provide a more complete understanding of VKORC1L1's physiological roles and therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.