Recombinant Human Voltage-dependent calcium channel gamma-6 subunit (CACNG6)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Calcium Channel Regulation

CACNG6 stabilizes voltage-gated L-type calcium channels (VLCCs) by maintaining their inactive state, modulating intracellular Ca²⁺ influx in excitable cells . Key functional insights include:

  • Regulatory Role: Interacts with VLCCs containing CACNA1C (α-1 subunit) to influence synaptic plasticity and neuronal signaling .

  • Association with TARPs: Functions as a transmembrane AMPA receptor regulatory protein (TARP), linking calcium signaling to glutamatergic neurotransmission .

Research Applications

Recombinant CACNG6 is widely used in:

  • Antibody Development: Serves as an antigen for generating antibodies in competition assays .

  • Mechanistic Studies: Explores calcium channel dysfunction in neurological and respiratory diseases .

Table 3: Disease-Associated CACNG6 Variants

DiseaseSNP/RegionEffect Size (OR)P-Value
Aspirin-Intolerant Asthmars192808 2.88–2.990.0004–0.0036
Schizophreniars192808-rs2048137 0.6222.93 × 10⁻⁶

Production and Quality Control

  • Purity: >0.5 mg/mL (verified via SDS-PAGE and HPLC) .

  • Storage: Stable at -20°C in PBS/urea buffer .

Future Directions

  • Therapeutic Targeting: CACNG6’s role in calcium signaling pathways offers potential for treating asthma and SCZ .

  • Functional Genomics: Unraveling CACNG6-CACNG5 epistasis could clarify calcium channelopathies in neuropsychiatric disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CACNG6; Voltage-dependent calcium channel gamma-6 subunit; Neuronal voltage-gated calcium channel gamma-6 subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL LTLPSWPWGSLCPKRGHRAT
Uniprot No.

Target Background

Function
Regulates the activity of L-type calcium channels that contain CACNA1C as the pore-forming subunit.
Gene References Into Functions
  1. CACNG6 variants may be associated with the risk of aspirin-intolerant asthma in a Korean population. PMID: 20860846
Database Links

HGNC: 13625

OMIM: 606898

KEGG: hsa:59285

STRING: 9606.ENSP00000252729

UniGene: Hs.631560

Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart left ventricle.

Q&A

What is the molecular structure of CACNG6?

CACNG6 (Voltage-dependent calcium channel gamma-6 subunit) is an integral membrane protein with four transmembrane domains spanning 260 amino acids in length . It belongs to the calcium channel gamma subunits family, which comprises eight members, and is specifically classified within the PMP-22/EMP/MP20 family . The protein is encoded by the CACNG6 gene in humans and has a UniProt ID of Q9BXT2 . The complete amino acid sequence is:

MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT

What are the primary functions of CACNG6 in cellular physiology?

CACNG6 serves multiple critical functions in cellular physiology. Primarily, it regulates the activity of L-type calcium channels that contain CACNA1C as the pore-forming subunit . The protein stabilizes calcium channels during their inactive state, directly influencing calcium influx in excitable cells such as neurons, muscle cells, and glial cells . Additionally, it functions as a transmembrane AMPA receptor regulatory protein (TARP), suggesting roles beyond calcium channel regulation . In the broader physiological context, CACNG6 contributes to calcium homeostasis, which is essential for numerous cellular processes including neurotransmission, muscle contraction, and immune cell activation .

How is the CACNG6 gene organized and regulated?

The CACNG6 gene undergoes alternative splicing, resulting in the production of multiple transcript variants . It is part of a versatile octaprotein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster of two family members . The gene's expression is likely regulated through tissue-specific transcription factors, epigenetic modifications, and post-transcriptional mechanisms, though specific regulatory elements remain under investigation. Understanding the regulatory mechanisms of CACNG6 expression is crucial for comprehending its role in various physiological and pathological conditions.

What are the optimal conditions for expressing recombinant CACNG6 protein?

For successful expression of functional recombinant CACNG6 protein, mammalian expression systems are generally preferred due to the protein's multiple transmembrane domains and complex folding requirements. HEK293 cells have been effectively used in previous studies . When using the TaqMan assay system, researchers have successfully worked with 20 ng of genomic DNA in the ABI prism 7900HT sequence detection system . For experiments involving polymorphism studies, maintaining stringent quality control by including duplicate DNA samples is recommended . The specific conditions should be optimized based on the experimental goals, whether for structural studies, functional assays, or protein-protein interaction analyses.

What methodologies are effective for studying CACNG6 genetic variants?

Several methodologies have proven effective for studying CACNG6 genetic variants:

  • Genotyping approaches: TaqMan assay has been successfully employed to genotype CACNG6 polymorphisms in clinical studies .

  • Statistical analyses: For association studies, logistic regression analyses adjusted for relevant covariates (age, gender, smoking status, atopy, and body mass index) provide robust results .

  • Linkage disequilibrium calculation: Using Lewontin's D' (|D'|) and r² metrics helps assess the relationship between biallelic loci .

  • Haplotype inference: The PHASE algorithm (version 2.0) developed by Stephens et al. has been effectively used for inferring haplotypes in CACNG6 studies .

  • Linear regression analysis: This approach helps determine differences in clinical characteristics among different genotypes and can be particularly useful for quantitative traits like methacholine sensitivity .

How can researchers measure CACNG6 activity in experimental settings?

Measuring CACNG6 activity requires specialized techniques due to its role as a regulatory subunit. Electrophysiological methods, particularly patch-clamp recordings, are essential for assessing calcium channel function in cells expressing CACNG6. Parameters to measure include activation voltage, inactivation kinetics, and current density. Calcium imaging techniques using fluorescent indicators can monitor intracellular calcium levels in response to channel activation. Co-immunoprecipitation assays help detect interactions with channel pore subunits, while surface biotinylation quantifies membrane expression levels. When interpreting results, it's important to account for endogenous calcium channel subunits that may influence measurements of recombinant CACNG6 activity.

How are CACNG6 polymorphisms associated with respiratory diseases?

CACNG6 polymorphisms have been significantly associated with aspirin-intolerant asthma (AIA), a condition characterized by aspirin sensitivity, asthma, and nasal polyposis . A single nucleotide polymorphism (SNP) rs192808C>T showed significant association with AIA risk (P = 0.0004, Pcorr = 0.0029, OR = 2.88 in co-dominant model; P = 0.0005, Pcorr = 0.0036, OR = 2.99 in dominant model) . Additionally, a haplotype unique to this variant (CACNG6_BL1_ht6) demonstrated strong association with AIA risk (P = 0.003, Pcorr = 0.02, OR = 2.57 in co-dominant model, P = 0.001, Pcorr = 0.0087, OR = 2.81 in dominant model) . These genetic associations suggest that CACNG6 plays a role in the pathophysiology of asthma, particularly in aspirin-intolerant individuals, and may contribute to the underlying mechanisms of airway inflammation and hyperresponsiveness.

What is the mechanism by which CACNG6 influences calcium signaling in inflammatory conditions?

CACNG6 influences calcium signaling in inflammatory conditions through its role in regulating calcium channels. The protein stabilizes calcium channels during their inactive state, thereby controlling calcium influx into cells . In inflammatory conditions such as asthma, abnormal Ca²⁺ influx may induce leukotriene overproduction from mast cells . This leads to the recruitment of other immune cells, such as eosinophils, resulting in vasospasm through eosinophilic infiltration and altered cardiac contractility .

The mechanism involves:

  • CACNG6 regulation of L-type calcium channels

  • Altered calcium influx in cells like mast cells

  • Calcium-dependent leukotriene production

  • Recruitment and activation of inflammatory cells

  • Tissue inflammation and physiological changes

This mechanism explains why CACNG6 polymorphisms might affect susceptibility to inflammatory conditions like aspirin-intolerant asthma.

How does azelastine interact with calcium channels in relation to CACNG6 function?

Azelastine, a medication used in asthma treatment, works by blocking L-type calcium channels, thereby preventing Ca²⁺ current . This mechanism of action is directly related to CACNG6 function, as CACNG6 stabilizes these calcium channels during their inactive state . By blocking the calcium channels that CACNG6 helps regulate, azelastine effectively prevents the abnormal calcium influx that contributes to inflammatory processes in conditions like asthma. This relationship between azelastine and CACNG6-regulated calcium channels highlights the importance of understanding calcium channel biology in developing and optimizing treatments for respiratory and inflammatory conditions.

What are the challenges in studying CACNG6 interactions with other channel components?

Studying CACNG6 interactions with other channel components presents several challenges:

  • Membrane protein complexity: As a transmembrane protein with four transmembrane domains, CACNG6 is difficult to isolate and study while maintaining its native conformation and function .

  • Multiple interaction partners: CACNG6 interacts with various components of calcium channels, particularly the pore-forming CACNA1C subunit, creating a complex interaction network that is challenging to dissect .

  • Dynamic interactions: The interactions between CACNG6 and other channel components are likely dynamic and state-dependent, requiring sophisticated techniques to capture and characterize.

  • Functional redundancy: With eight members in the calcium channel gamma subunit family, potential functional redundancy complicates the interpretation of experimental results.

  • Tissue-specific interactions: CACNG6 interactions may vary across different tissues and cell types, necessitating context-specific investigation approaches.

Addressing these challenges requires combining multiple techniques, including structural biology, electrophysiology, protein biochemistry, and advanced imaging methods.

How do alternative splicing variants of CACNG6 affect its function?

The CACNG6 gene undergoes alternative splicing, resulting in multiple transcript variants . These splicing variants likely produce protein isoforms with distinct functional properties, potentially affecting:

  • Channel modulation capabilities: Different isoforms may have varied effects on calcium channel kinetics, voltage-dependence, and inactivation properties.

  • Interaction profiles: Alternative splicing could modify interaction domains, altering CACNG6's ability to bind to other channel components or regulatory proteins.

  • Subcellular localization: Certain splicing variants might contain or lack targeting signals that direct the protein to specific subcellular compartments.

  • Tissue distribution: Expression of specific splice variants may be tissue-dependent, contributing to specialized calcium channel functions in different cell types.

  • Disease susceptibility: As observed with the association between CACNG6 variants and aspirin-intolerant asthma, certain splice variants may influence disease risk or progression .

Further research is needed to characterize the functional differences between CACNG6 splice variants and their physiological and pathological implications.

What approaches can resolve contradictory findings in CACNG6 research?

Resolving contradictory findings in CACNG6 research requires systematic approaches:

  • Standardized methodology: Implement consistent experimental protocols across studies, including standardized expression systems, electrophysiological recording conditions, and data analysis methods.

  • Comprehensive genetic analysis: When studying polymorphisms, ensure thorough genotyping of all relevant variants and consider population stratification issues .

  • Integrative data analysis: Combine data from multiple techniques and study types using meta-analysis approaches, particularly for genetic association studies across different populations .

  • Context-specific investigation: Account for tissue-specific, developmental, and physiological context in experimental design and interpretation.

  • Collaborative validation: Establish multi-laboratory validation studies to confirm key findings through independent replication.

  • Improved modeling: Develop more sophisticated in vitro and in vivo models that better recapitulate the complexity of CACNG6 biology and function.

By applying these approaches, researchers can address discrepancies in the literature and develop a more coherent understanding of CACNG6 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.