Recombinant Human Voltage-dependent calcium channel gamma-like subunit (TMEM37)

Shipped with Ice Packs
In Stock

Description

Introduction to TMEM37 and Its Recombinant Form

TMEM37 (transmembrane protein 37), also known as the voltage-dependent calcium channel gamma-like subunit, is a transmembrane protein critical for calcium channel regulation. It stabilizes calcium channels in an inactivated state and modulates calcium currents when co-expressed with subunits like CACNA1G . Recombinant TMEM37 is engineered for research and therapeutic applications, typically expressed in E. coli or mammalian systems (e.g., HEK293) .

Key Features of Recombinant TMEM37:

PropertyDetail
SourceE. coli or mammalian cells (e.g., HEK293)
TagHis-tag (N-terminal) for purification
Purity≥90% (SDS-PAGE validated)
Molecular Weight~20.9 kDa (190 residues)
FunctionCalcium channel activity, voltage-gated ion channel modulation

Recombinant Production and Applications

Recombinant TMEM37 is produced for studying ion channel dynamics, drug discovery, and disease modeling.

Research Applications:

  • Drug Discovery: Used as a positive control in calcium channel inhibitor screens .

  • Pathway Studies: Investigates interactions with CACNA1G, HBP1, and ORM1 .

  • Disease Modeling: Explores roles in ischemic cardiomyopathy and synaptic disorders .

Interacting Proteins and Pathways

TMEM37 interacts with key molecules in calcium signaling and synaptic regulation.

Interacting Partners (STRING Database):

ProteinFunction/PathwayInteraction ScoreSource
CACNA1GT-type calcium channel subunitHigh
HBP1Hemoglobin-binding protein0.789
ORM1Alpha-1-antichymotrypsin precursor0.789
CACNG5Calcium channel gamma subunit 5Phylogenetic

Key Pathways:

PathwayRole of TMEM37Related Proteins
MAPK SignalingModulates calcium-dependent signalingCACNA1D, RPS6KA2
AMPA Receptor RegulationControls synaptic plasticityCACNG5, CACNG7

Research Findings and Clinical Relevance

  • Functional Modulation: Co-expression with CACNA1G reduces calcium current density in heterologous systems .

  • Neurological Implications: Linked to AMPA receptor trafficking defects in synaptic disorders .

  • Therapeutic Potential: Targeted in studies on ischemic cardiomyopathy and calcium channelopathies .

Future Directions

  1. Structural Elucidation: High-resolution cryo-EM studies to map TMEM37-calcium channel interactions.

  2. Disease Mechanisms: Investigating TMEM37’s role in schizophrenia and bipolar disorder (linked to CACNG5/7 clusters) .

  3. Therapeutic Development: Screening small molecules that disrupt TMEM37-AMPA receptor interactions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM37; PR; Voltage-dependent calcium channel gamma-like subunit; Neuronal voltage-gated calcium channel gamma-like subunit; Transmembrane protein 37
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM37
Target Protein Sequence
MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGL WHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHS QCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGL HINSITHPWE
Uniprot No.

Target Background

Function
This protein is believed to stabilize the calcium channel in an inactivated (closed) state. When coexpressed with CACNA1G, it modulates calcium current.
Database Links

HGNC: 18216

KEGG: hsa:140738

STRING: 9606.ENSP00000303148

UniGene: Hs.26216

Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the tissue expression profile of TMEM37 and how does it vary across human tissues?

TMEM37 demonstrates a distinct tissue-specific expression pattern. The protein shows highest expression in kidney, liver, and adipose tissue, with moderate expression in several other tissue types. This differential expression suggests tissue-specific functions that may relate to calcium homeostasis requirements across various organs.

Expression data across major tissues indicates:

TissueGTEx CoverageGTEx Average TPMTCGA CoverageTCGA Average TPM
Kidney100%5618.1591%183.21
Liver100%3945.5098%102.87
Adipose99%2772.680%0
Intestine61%2273.8772%23.19
Spleen98%2015.160%0
Breast94%1981.6949%12.60
Thymus100%1794.7398%83.11

For experimental designs investigating TMEM37, these expression patterns should inform tissue selection, with kidney and liver representing optimal models for high-expression systems .

Which cell types predominantly express TMEM37?

When designing cell-based experiments, researchers should consider the following cell type-specific expression patterns:

Cell TypeNumber of studiesAverage coverage
Epithelial cell3 studies44% ± 20%
Mueller cell3 studies39% ± 10%
Enterocyte6 studies31% ± 11%
Epithelial cell of proximal tubule6 studies27% ± 11%
Kidney loop of Henle epithelial cell4 studies25% ± 4%
Macrophage6 studies25% ± 7%
Endothelial cell4 studies25% ± 9%

This cell type distribution aligns with the tissue expression data, particularly the high expression in kidney and intestinal tissues. For in vitro studies, epithelial cell lines derived from kidney or intestinal tissue would provide physiologically relevant models .

What is the functional classification of TMEM37 based on Gene Ontology?

TMEM37 is classified under the Gene Ontology term GO_0070588, corresponding to calcium ion transmembrane transport. This functional annotation aligns with its structural classification as a voltage-dependent calcium channel gamma-like subunit, indicating its involvement in regulating calcium flux across cellular membranes .

When designing functional assays, researchers should incorporate calcium imaging or electrophysiological techniques to directly measure TMEM37's impact on calcium channel activity rather than relying solely on expression analysis.

What bioinformatic workflows are recommended for analyzing TMEM37 expression in high-throughput datasets?

For comprehensive analysis of TMEM37 expression:

  • For RNA-seq data: Process normalized RNA-seq data using standard bioinformatic pipelines. The TCGA dataset analysis included 24,991 genes after normalization .

  • For microarray data: Process CEL source files using the Robust Multi-array Average (RMA) algorithm, which includes:

    • Background adjustment to correct for non-specific binding

    • Quantile normalization to make distributions comparable across samples

    • Summarization to combine multiple probe signals into a single expression value

    • Log2 transformation to improve data distribution properties

  • For differential expression analysis:

    • Apply Student's t-test between comparison groups

    • Establish significance thresholds (typically P < 0.05 and fold change > 2 or < 1/2)

    • Validate findings across multiple datasets when possible

This standardized approach ensures consistency and reproducibility when analyzing TMEM37 expression across different experimental conditions.

How can researchers integrate TMEM37 expression data with clinical outcomes for prognostic analysis?

For robust prognostic analysis:

  • Categorize samples into high and low expression groups based on mean TMEM37 expression values .

  • Perform survival estimation using the Kaplan-Meier method, which accounts for censored data common in clinical studies .

  • Compare survival curves using the log-rank test to determine statistical significance of differences between expression groups .

  • Calculate hazard ratios using the Cox proportional risk regression model:

    • For univariate analysis, examine TMEM37 expression alone

    • For multivariate analysis, incorporate relevant clinical covariates to identify independent prognostic factors

  • Validate findings across multiple independent cohorts, as demonstrated in colorectal cancer research using datasets GSE17536, GSE39582, and TCGA .

This methodological framework has successfully identified TMEM37 as a potential prognostic marker for disease-free survival in colorectal cancer.

What experimental approaches are most suitable for validating TMEM37's functional role in calcium channel regulation?

To validate TMEM37's function as a calcium channel subunit:

  • Electrophysiological approaches:

    • Patch-clamp recording in heterologous expression systems

    • Comparison of calcium currents in cells with and without TMEM37 expression

    • Determination of channel kinetics and voltage-dependence parameters

  • Calcium imaging techniques:

    • Fluorescent calcium indicators (e.g., Fura-2, Fluo-4) to monitor intracellular calcium

    • Real-time measurement of calcium transients in response to stimuli

    • Single-cell analysis to account for cellular heterogeneity

  • Interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • FRET-based approaches to assess protein-protein interactions

    • Proximity ligation assays to confirm interactions in situ

When designing these experiments, researchers should consider the endogenous expression patterns to select appropriate cellular models that reflect physiological contexts where TMEM37 functions.

What evidence exists for TMEM37 as a prognostic biomarker in colorectal cancer?

Current evidence suggests TMEM37 may serve as a prognostic marker in colorectal cancer, particularly for disease-free survival (DFS). In comprehensive bioinformatic analyses integrating multiple datasets (TCGA, GSE17536, GSE39582), TMEM37 was identified as one of the "outstanding mRNAs" associated with patient outcomes .

The analytical approach involved:

While the specific relationship between TMEM37 expression levels and patient outcomes requires further validation, its identification through rigorous statistical methods suggests potential clinical utility. Researchers investigating TMEM37 as a biomarker should employ similar comprehensive methodologies spanning discovery and validation phases.

How should researchers interpret contradictory findings about TMEM37 function across different studies?

When faced with conflicting results regarding TMEM37:

  • Examine methodological differences:

    • RNA extraction and quality assessment protocols

    • Expression quantification platforms (microarray vs. RNA-seq)

    • Normalization strategies and statistical approaches

    • Cell lines or tissue sources used across studies

  • Consider biological variables:

    • Tissue heterogeneity and cell type composition

    • Patient characteristics and disease stages

    • Treatment history and environmental factors

    • Genetic background and potential modifier genes

  • Perform meta-analysis:

    • Standardize expression values across datasets

    • Apply random-effects models to account for inter-study variability

    • Assess publication bias systematically

  • Design validation experiments:

    • Use multiple complementary techniques (qPCR, Western blot, functional assays)

    • Include appropriate positive and negative controls

    • Ensure adequate statistical power based on expected effect sizes

This systematic approach can reconcile apparently contradictory findings and establish a more definitive understanding of TMEM37's functional roles and expression patterns.

How does TMEM37 expression differ between normal and malignant tissues?

While the complete comparative analysis is not fully detailed in the available data, the identification of TMEM37 as a differentially expressed mRNA (DEM) in the TCGA colorectal cancer dataset suggests significant expression differences between cancer and para-carcinoma tissues .

For researchers investigating these differences:

  • Apply stringent criteria for differential expression analysis:

    • Statistical significance threshold (P < 0.05)

    • Fold change cutoff (> 2 or < 1/2) to identify biologically meaningful changes

    • Multiple testing correction to control false discovery rate

  • Validate findings using orthogonal methods:

    • qRT-PCR for transcript quantification

    • Western blot or immunohistochemistry for protein-level confirmation

    • Analysis of multiple independent cohorts

  • Contextualize expression differences:

    • Consider tissue-specific expression patterns

    • Evaluate correlation with disease stage and progression

    • Assess relationship to other established biomarkers

This comprehensive approach will provide robust insights into TMEM37's differential expression and potential contribution to malignant phenotypes.

How might TMEM37's function as a calcium channel subunit contribute to its potential role in cancer biology?

The identification of TMEM37 as a prognostic marker in colorectal cancer suggests potential mechanistic connections between calcium signaling and cancer progression. Calcium signaling plays crucial roles in numerous cancer-related processes:

  • Cell proliferation and cell cycle regulation:

    • Calcium oscillations influence checkpoint progression

    • Alteration of calcium channel activity can affect proliferative capacity

  • Apoptosis and cell survival:

    • Calcium overload can trigger mitochondrial dysfunction and cell death

    • Dysregulation of calcium homeostasis may confer resistance to apoptosis

  • Cell migration and metastasis:

    • Calcium signaling regulates cytoskeletal dynamics and cellular motility

    • Altered calcium flux can enhance invasive potential

As a voltage-dependent calcium channel subunit, TMEM37 may modulate these processes through regulation of calcium influx, potentially explaining its prognostic significance in colorectal cancer. Researchers investigating this connection should design experiments targeting specific calcium-dependent pathways in relevant cancer models.

What epigenetic mechanisms might regulate TMEM37 expression across different tissues?

The variable expression of TMEM37 across tissues suggests tissue-specific regulatory mechanisms. Although direct evidence for epigenetic regulation of TMEM37 is not provided in the available data, researchers could investigate:

  • DNA methylation patterns:

    • Promoter methylation analysis in high vs. low expressing tissues

    • Correlation between methylation status and expression levels

    • Effects of demethylating agents on TMEM37 expression

  • Histone modifications:

    • ChIP-seq analysis of activating (H3K4me3, H3K27ac) and repressive (H3K27me3, H3K9me3) marks

    • Tissue-specific enhancer profiles

    • Response to histone deacetylase inhibitors

  • Non-coding RNAs:

    • miRNA binding site analysis within TMEM37 3'UTR

    • Long non-coding RNA interactions

    • circRNA regulatory networks

Understanding these epigenetic mechanisms could provide insights into the tissue-specific regulation of TMEM37 and potentially reveal new approaches for modulating its expression in disease contexts.

What biophysical properties of TMEM37 determine its calcium channel modulatory function?

As a voltage-dependent calcium channel gamma-like subunit, TMEM37's function likely depends on specific structural and biophysical properties. Advanced research approaches to investigate these properties include:

  • Structure-function analysis:

    • Site-directed mutagenesis of key residues

    • Electrophysiological characterization of mutants

    • Correlation between sequence variants and functional outcomes

  • Protein dynamics:

    • Molecular dynamics simulations

    • Single-molecule FRET to capture conformational changes

    • Analysis of protein flexibility and stability

  • Interaction surfaces:

    • Identification of binding domains for channel alpha subunits

    • Mapping of critical interaction interfaces

    • Competition assays with peptide mimetics

These approaches can provide mechanistic insights into how TMEM37 regulates calcium channel function, potentially revealing targets for selective modulation in research or therapeutic contexts.

How can single-cell analysis advance our understanding of TMEM37 function in heterogeneous tissues?

Given the cell type-specific expression patterns of TMEM37, single-cell approaches offer powerful tools for deeper functional characterization:

  • Single-cell RNA-seq to:

    • Resolve expression in rare cell populations

    • Identify co-expression networks

    • Map developmental or disease-related expression trajectories

  • Single-cell proteomics to:

    • Quantify protein-level expression

    • Assess post-translational modifications

    • Correlate with functional states

  • Spatial transcriptomics to:

    • Preserve tissue architecture information

    • Identify spatial expression patterns

    • Reveal neighborhood effects on expression

These approaches can overcome limitations of bulk analysis, particularly in heterogeneous tissues like kidney where TMEM37 shows high expression across multiple specialized cell types.

What are the optimal experimental systems for studying TMEM37 interactions with other calcium channel subunits?

To investigate TMEM37's interactions with channel partners:

  • Heterologous expression systems:

    • Selection of appropriate cell backgrounds with minimal endogenous channel expression

    • Controlled co-expression of channel subunits

    • Quantitative assessment of stoichiometry and assembly

  • Native tissue approaches:

    • Proximity labeling techniques (BioID, APEX) in relevant tissues

    • Native protein complex isolation under non-denaturing conditions

    • In situ visualization of protein complexes

  • Reconstitution systems:

    • Purified protein interaction studies

    • Lipid bilayer reconstitution

    • Cryo-EM structural analysis of assembled complexes

The selection of experimental system should be guided by the specific research question and the expression profile of TMEM37 across tissues and cell types.

How can computational methods predict the impact of TMEM37 variants on calcium channel function?

For researchers investigating TMEM37 genetic variants:

  • Sequence-based prediction tools:

    • Conservation analysis across species

    • Variant effect prediction algorithms (SIFT, PolyPhen)

    • Evaluation of domain disruption

  • Structural modeling approaches:

    • Homology modeling based on related proteins

    • Ab initio structure prediction

    • Molecular dynamics to assess variant impact

  • Machine learning integration:

    • Training models on known functional variants

    • Feature extraction from multiple data sources

    • Variant classification and prioritization

These computational approaches can guide experimental design by identifying high-priority variants for functional validation, particularly for researchers investigating the relationship between TMEM37 genetic variation and disease risk.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.