Recombinant Human Vomeronasal type-1 receptor 1 (VN1R1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant VN1R1 is generated using diverse expression platforms to ensure proper folding and functionality:

Expression SystemAdvantagesApplications
Cell-FreeHigh purity, no host-cell contaminants Structural studies, antibody production
HEK-293 CellsPost-translational modifications, mammalian membrane compatibility Functional assays, ligand screening
Wheat GermCost-effective, scalable for large yields Immunogen development, basic research

For example, MyBioSource offers a ≥85% pure recombinant VN1R1 product expressed in a cell-free system, validated via SDS-PAGE .

Ligand Activation and Neuromodulation

  • Hedione, a synthetic jasmine odorant, binds VN1R1 and triggers sex-differentiated hypothalamic activation, enhancing hormonal responses in women compared to men .

  • Functional MRI studies show Hedione activates the amygdala and hippocampus, linking VN1R1 to emotional and memory-related pathways .

Genetic Polymorphisms and Behavior

  • The VN1R1 rs28649880 (A229D) polymorphism correlates with sociosexual behavior in women, particularly one-night stand frequency .

  • Allelic variants (1a: 26.35%, 1b: 73.65%) exist, but no gender-specific distribution was observed, suggesting broader behavioral modulation .

Expression in Non-Olfactory Tissues

  • VN1R1 is detected in the lung, kidney, and brain, hinting at roles beyond pheromone detection, such as interorgan signaling .

Antibody Development

  • Polyclonal antibodies (e.g., PACO61145) target VN1R1 residues 1–56 for use in Western blotting and immunofluorescence, confirming receptor expression in HeLa, A549, and PC-3 cell lines .

  • Antibody validation supports neuroscience studies exploring pheromone signaling pathways .

Ligand Interaction Studies

  • Recombinant VN1R1 enables high-throughput screening for ligands, aiding drug discovery for behavioral or hormonal disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
VN1R1; V1RL1; VNR19I1; Vomeronasal type-1 receptor 1; G-protein coupled receptor GPCR24; hGPCR24; V1r-like receptor 1; V3r-related gene protein; Vomeronasal olfactory receptor chromosome 19 subtype I member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VN1R1
Target Protein Sequence
MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGI LGNSFLLCFYNLILFTGHKLRPTDLILSQLALANSMVLFFKGIPQTMAAFGLKYLLNDTG CKFVFYYHRVGTRVSLSTICLLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWAPHV LMNASVLLLVNGPLNSKNSSAKNNYGYCSYKASKRFSSLHAVLYFSPDFMSLGFMVWASG SMVFFLYRHKQQVQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVA NPGQWIVTNSVLVASCFPARSPFVLIMSDTHISQFCFACRTRKTLFPNLVVMP
Uniprot No.

Target Background

Function
Putative pheromone receptor.
Gene References Into Functions
  1. This study suggests that genetic variation in VN1R1 affects women's socio-sexual behavior through endogenous modulation of receptor function, indicating human chemo-signaling communication. PMID: 28440809
  2. Structure and function analyses of purified human vomeronasal type 1 receptor 1. PMID: 22355687
  3. The human VN1R1 gene is unlikely to be associated with gender or contribute to gender-specific behavior. PMID: 17627382
Database Links

HGNC: 13548

OMIM: 605234

KEGG: hsa:57191

STRING: 9606.ENSP00000322339

UniGene: Hs.677423

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the olfactory mucosa, very low expression in brain, lung and kidney.

Q&A

What is the basic structure of human VN1R1 and how does it compare to other vomeronasal receptors?

Human VN1R1 belongs to the vomeronasal receptor family, which are G protein-coupled receptors (GPCRs) with seven putative transmembrane domains. The V1R family, which includes VN1R1, shares between 50-90% sequence identity among its members but has limited similarity to other GPCR families . These receptors appear evolutionarily related to mammalian T2R bitter taste receptors and rhodopsin-like GPCRs . Unlike the extensively diversified V1R repertoire in rodents (30-40 genes in rats), humans retain primarily pseudogenes with VN1R1 being one of the few potentially functional receptors identified in the human genome .

The protein structure features characteristic motifs of GPCRs, including conserved residues essential for signal transduction. When expressed recombinantly, human VN1R1 maintains the structural features necessary for membrane insertion and potential ligand binding, though its three-dimensional conformation may differ slightly from its native state due to post-translational modifications.

What is the genomic location and organization of the human VN1R1 gene?

The human VN1R1 gene is located on Chromosome 19 in the human genome . This positioning is significant as it places VN1R1 in a chromosomal region that contains several other chemosensory receptor genes. The genomic organization of VN1R1 reflects its evolutionary history within the primate lineage, showing characteristics of a gene that has undergone significant selective pressure.

The gene structure includes coding regions that translate to the functional domains of the receptor protein. Unlike most V1R genes in humans which have accumulated mutations rendering them non-functional (pseudogenes), VN1R1 appears to have maintained an open reading frame capable of producing a functional receptor protein . This genomic preservation suggests potential biological significance despite the general regression of the vomeronasal system in higher primates.

What is the putative function of VN1R1 in humans given the apparent absence of a functional vomeronasal organ?

Despite the absence of a functional vomeronasal organ (VNO) in adult humans, VN1R1 appears to be expressed in the main olfactory epithelium rather than the vestigial VNO . This suggests a potential repurposing of this receptor in human chemosensation. While classical vomeronasal receptors detect pheromones in many mammals, the human VN1R1 may have evolved to recognize different classes of chemical signals or may participate in non-chemosensory functions.

Current research indicates that VN1R1 may contribute to unconscious social chemical communication or may have been co-opted for other sensory or cellular functions outside traditional pheromone detection . The retention of a functional VN1R1 gene in humans, despite the pseudogenization of most other V1R genes, suggests selective pressure has maintained this receptor for some biological purpose, possibly related to reproductive physiology, social behavior, or other specialized chemosensory functions not requiring a dedicated VNO .

What are the most effective expression systems for producing recombinant human VN1R1 protein?

The production of functional recombinant VN1R1 requires careful consideration of expression systems that can properly fold and post-translationally modify this seven-transmembrane domain protein. Based on current research protocols, mammalian cell expression systems (particularly HEK293 and CHO cells) have proven most effective for VN1R1 expression due to their ability to perform appropriate glycosylation and proper membrane insertion.

When using mammalian expression systems, the following methodological considerations are critical:

  • Vector selection: Vectors containing strong mammalian promoters (CMV, EF1α) yield better expression levels

  • Signal sequence optimization: Including optimized signal peptides improves membrane trafficking

  • Fusion tags: C-terminal tags (His6, FLAG) facilitate purification with minimal interference with function

  • Induction conditions: Temperature reduction to 30°C after induction often improves folding

  • Detergent selection: Mild detergents like DDM or LMNG better preserve protein structure during solubilization

Insect cell systems (Sf9, High Five) represent an alternative approach with potentially higher yields, though mammalian systems generally produce more functionally authentic human VN1R1. Bacterial systems typically fail to produce properly folded receptor due to the lack of appropriate post-translational modifications and membrane insertion machinery.

What detection methods are most sensitive for studying VN1R1 expression in human tissues?

Detection of VN1R1 in human tissues presents significant challenges due to its relatively low expression levels. A multi-modal approach employing complementary techniques yields the most reliable results. Antibody-based methods using highly specific antibodies, such as the VN1R1 Polyclonal Antibody (PAC061145), have proven effective in Western blotting, immunofluorescence, and ELISA applications .

For Western blot analysis, optimized protocols involve:

  • Sample preparation with specialized membrane protein extraction buffers

  • Reduced denaturation temperatures (37°C instead of boiling) to prevent aggregation

  • Gradient gels (4-15%) for optimal separation

  • Transfer conditions optimized for hydrophobic proteins (inclusion of 20% methanol)

  • Extended blocking steps to reduce background

  • Primary antibody dilutions of 1:500-1:5000 as recommended for the VN1R1 antibody

For immunofluorescence applications, tissue preparation with minimal fixation (2% paraformaldehyde for 15-20 minutes) and the use of detergent permeabilization steps tailored to preserve epitope accessibility are recommended. Antibody dilutions of 1:50-1:200 have been successfully employed .

For mRNA detection, quantitative RT-PCR with primers designed to span exon-exon junctions prevents genomic DNA amplification. RNA-seq approaches can also detect VN1R1 transcripts, though specialized library preparation protocols may be necessary for low-abundance transcripts.

What are the recommended methods for assessing the functional activity of recombinant VN1R1?

Functionally characterizing recombinant VN1R1 requires specialized assays that can detect receptor activation in response to potential ligands. Several complementary approaches have been developed:

  • Calcium mobilization assays: Cells expressing VN1R1 are loaded with calcium-sensitive fluorescent dyes (Fluo-4 AM) and receptor activation is measured as changes in intracellular calcium upon ligand binding. This approach requires co-expression of appropriate G proteins, typically Gα15/16 chimeras that couple to calcium signaling.

  • BRET/FRET-based assays: These energy transfer techniques allow real-time monitoring of protein-protein interactions involved in receptor activation. For VN1R1, this typically involves measuring the dissociation of G-protein subunits upon receptor activation.

  • GTPγS binding assays: This biochemical approach measures the exchange of GDP for GTPγS (a non-hydrolyzable GTP analog) upon receptor activation, providing a quantitative measure of G-protein coupling efficiency.

  • Impedance-based assays: These label-free techniques measure changes in cellular morphology upon receptor activation using specialized microelectrode arrays.

  • Receptor internalization assays: Fluorescently labeled VN1R1 can be monitored for endocytosis following ligand binding, providing a downstream measure of receptor activation.

The choice of assay depends on the specific research question, with calcium mobilization assays being the most widely used for initial screening, while BRET/FRET approaches provide more mechanistic insights into receptor signaling dynamics.

How does VN1R1 expression vary across different human tissues and cell types?

While traditionally associated with chemosensory functions, research has revealed an unexpectedly diverse expression pattern for VN1R1 across human tissues. Unlike most vomeronasal receptors that exhibit highly restricted expression, VN1R1 transcripts have been detected in several unexpected locations.

The primary sites of VN1R1 expression include:

  • Main olfactory epithelium: Unlike other V1R receptors that are primarily expressed in the vomeronasal organ in other mammals, human VN1R1 is expressed in the main olfactory epithelium .

  • Testicular tissue: Significant expression has been detected in male reproductive tissues, suggesting potential roles in gamete recognition or reproductive physiology.

  • Specific neuronal populations: Beyond olfactory neurons, VN1R1 expression has been detected in discrete neuronal populations in the central nervous system.

  • Cancer cell lines: Several studies have found VN1R1 expression in human cancer cell lines, particularly in HeLa, LO2, A549, and PC-3 cell lines, as demonstrated by Western blot analysis using specific antibodies .

This diverse expression pattern suggests that VN1R1 may serve functions beyond traditional chemosensation. The presence of VN1R1 in non-olfactory tissues indicates potential roles in intercellular signaling, development, or other physiological processes that remain to be fully characterized. Expression levels are typically low, necessitating sensitive detection methods such as qRT-PCR or specialized antibody-based techniques.

What are the potential implications of VN1R1 polymorphisms in human sensory perception?

Genetic variation in the VN1R1 gene may contribute to individual differences in chemosensory perception and potentially influence social behaviors. Several single nucleotide polymorphisms (SNPs) have been identified in the human VN1R1 gene, some of which result in amino acid substitutions that could affect receptor function.

While comprehensive population studies linking VN1R1 polymorphisms to phenotypic differences remain limited, emerging evidence suggests potential associations with:

  • Variation in sensitivity to specific odorants or social chemosignals

  • Individual differences in unconscious behavioral responses to certain chemical cues

  • Potential correlations with aspects of social cognition and partner preference

Research methodologies to investigate these associations typically involve:

  • Genotyping selected SNPs across diverse population samples

  • Conducting psychophysical tests to measure detection thresholds for specific compounds

  • Functional in vitro assays comparing signaling efficacy of receptor variants

  • Neuroimaging studies examining brain activation patterns in response to potential ligands

The functional consequences of these polymorphisms remain an active area of investigation, with potential implications for understanding human chemosensory diversity and its evolutionary significance.

What evidence exists for functional ligands of human VN1R1?

Identifying physiological ligands for human VN1R1 represents one of the most challenging aspects of research in this field. Unlike rodent vomeronasal receptors with well-characterized pheromone ligands, human VN1R1 ligands remain largely speculative. Several approaches have been employed to identify potential activating compounds:

  • High-throughput screening: Cell-based assays expressing recombinant VN1R1 have been used to screen chemical libraries, including steroids, peptides, and volatile compounds.

  • Evolutionary analysis: Comparative studies with functional V1R receptors in other mammals have suggested potential chemical classes that might activate human VN1R1.

  • Structural modeling: Computational approaches that model the ligand-binding pocket of VN1R1 based on known GPCR structures have predicted potential interacting molecules.

Current evidence suggests the following classes of compounds may interact with human VN1R1:

  • Certain steroidal derivatives, particularly those found in human secretions

  • Specific medium-chain fatty acids and their derivatives

  • Select volatile components identified in human body odors

How does human VN1R1 compare evolutionarily to vomeronasal receptors in other primates?

Human VN1R1 represents a fascinating case study in sensory receptor evolution within the primate lineage. Comparative genomic analyses reveal significant evolutionary dynamics across primates:

In New World monkeys like the marmoset (Callithrix jacchus), which possess an intact vomeronasal organ (VNO) and exhibit pheromone-induced behaviors, researchers have identified V1R-like sequences that, surprisingly, are non-functional pseudogenes . This contrasts with the expectation that species with functional VNOs would maintain functional V1R genes.

Among great apes, the evolutionary trajectory of VN1R1 homologs shows a mixed pattern:

  • The chimpanzee and orangutan V1RL1 genes are pseudogenes

  • The gorilla counterpart appears to have maintained potential functionality

  • The human VN1R1 gene has preserved an open reading frame despite the regression of the human VNO

This complex evolutionary pattern suggests that:

  • The V1R gene family has undergone significant lineage-specific evolution in primates

  • Each primate species may have evolved its own unique set of functional vomeronasal genes

  • Selective pressures have maintained certain V1R receptors while allowing others to pseudogenize

  • The preservation of functional VN1R1 in humans despite VNO regression suggests potential adaptive repurposing of this receptor for novel functions

These observations indicate that vomeronasal receptor evolution in primates cannot be explained by a simple model of gradual regression, but rather reflects complex adaptive processes potentially driven by changing environmental and social factors throughout primate evolution.

What functional differences have been observed between human VN1R1 and rodent V1R receptors?

Human VN1R1 and rodent V1R receptors exhibit significant functional differences reflecting their divergent evolutionary histories and distinct biological roles:

  • Expression patterns: While rodent V1Rs are primarily expressed in the vomeronasal organ (VNO) in apical regions where neurons express Gi2 protein , human VN1R1 is expressed in the main olfactory epithelium . This differential localization suggests fundamental differences in the sensory pathways involving these receptors.

  • Signaling mechanisms: Rodent V1Rs couple to Gi2 proteins, mediating inositol trisphosphate signaling . The signaling cascade for human VN1R1 remains less characterized but may involve different G-protein coupling partners given its expression in the main olfactory system.

  • Ligand specificity: Rodent V1Rs recognize volatile pheromones and mediate stereotypical social and sexual behaviors . In contrast, human VN1R1 likely responds to different chemical signals, possibly non-pheromonal odorants or as-yet-unidentified social chemosignals.

  • Genetic diversity: Rodents maintain large, diverse families of functional V1R genes (30-40 in rats) , while humans have predominantly pseudogenized their V1R repertoire, with VN1R1 being among the few potentially functional remnants .

  • Behavioral outcomes: Activation of rodent V1Rs triggers well-defined, innate behavioral responses related to reproduction and social hierarchy . Any behavioral effects of human VN1R1 activation would likely be subtler and potentially integrated with conscious olfactory perception rather than manifesting as stereotyped responses.

These functional differences highlight the significant evolutionary divergence in chemosensory systems between rodents and humans, with rodents maintaining a dedicated vomeronasal system for pheromone detection while humans have potentially repurposed remaining functional receptors like VN1R1 for alternative sensory functions.

What can the pseudogenization pattern of V1R genes in primates tell us about the functional significance of human VN1R1?

The widespread pseudogenization of V1R genes across primate lineages, juxtaposed with the maintenance of functional VN1R1 in humans, provides valuable insights into the potential significance of this receptor:

  • Selective preservation: The retention of a functional VN1R1 gene against a background of extensive V1R pseudogenization suggests that this specific receptor has been under positive selection pressure, implying continued biological importance .

  • Functional repurposing: The expression of human VN1R1 in the main olfactory epithelium rather than the vestigial vomeronasal organ suggests evolutionary repurposing of this receptor for functions distinct from classical pheromone detection .

  • Lineage-specific adaptations: The observation that "every species that relies on a VNO-mediated sensory function possesses its own set of functional vomeronasal genes" suggests that VN1R1 may have evolved to detect species-specific chemosignals relevant to human biology.

  • Temporal dynamics: Comparative analysis of pseudogenization patterns suggests that the loss of V1R functionality occurred at different time points across primate evolution, with some pseudogenization events predating the divergence of major primate lineages while others occurred more recently.

  • Correlation with behavioral complexity: The reduction of functional V1R genes correlates with increased social complexity and visual communication in higher primates, suggesting that VN1R1 may have been preserved to serve specialized functions compatible with human social cognition.

The pseudogenization pattern thus suggests that human VN1R1 likely represents more than an evolutionary remnant and may serve specialized sensory or signaling functions that have remained beneficial despite the general regression of the vomeronasal system in humans.

What are the critical factors for ensuring proper folding of recombinant human VN1R1?

Proper folding of recombinant human VN1R1 represents one of the most significant challenges in working with this protein due to its seven transmembrane domain structure and complex topological requirements. Several critical factors influence folding efficiency and functionality:

  • Expression temperature: Reducing cultivation temperature to 28-30°C after induction significantly improves proper folding by slowing protein synthesis and allowing more time for membrane insertion and folding.

  • Membrane environment: The lipid composition of expression host membranes critically affects VN1R1 folding. Supplementation with cholesterol and sphingolipids often improves functional yields by creating lipid microdomains that facilitate proper receptor conformation.

  • Chaperone co-expression: Co-expression of molecular chaperones, particularly those specialized for membrane proteins (e.g., CANX, CALR, and HSP70 family members), enhances correct folding of VN1R1.

  • Fusion partners: N-terminal fusions with well-folded soluble proteins (such as maltose-binding protein or thioredoxin) can increase proper folding by providing a nucleation point for the folding process, though these must be removed for functional studies.

  • Signal sequence optimization: Using optimized signal sequences for the expression system employed improves trafficking to the membrane, a prerequisite for proper folding.

  • Post-translational modifications: Ensuring the expression system can perform appropriate glycosylation is essential, as N-linked glycosylation at specific sites stabilizes the native conformation of VN1R1.

  • Disulfide bond formation: Maintaining an appropriate redox environment to allow correct formation of disulfide bonds, which are critical for stabilizing the tertiary structure of the receptor.

Monitoring folding efficiency typically involves functional assays combined with biochemical approaches such as limited proteolysis, which can distinguish between properly folded and misfolded receptor populations.

What purification strategies yield the highest recovery of functional recombinant human VN1R1?

Purifying functional recombinant human VN1R1 requires specialized approaches that maintain the native structure of this integral membrane protein throughout the extraction and purification process. The following strategy has demonstrated superior results:

  • Membrane preparation:

    • Harvest cells expressing VN1R1 at optimal time points (typically 48-72 hours post-induction for mammalian cells)

    • Disrupt cells using nitrogen cavitation rather than sonication to minimize denaturation

    • Separate membranes by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membrane pellets with high-salt buffer (500 mM NaCl) to remove peripheral proteins

  • Solubilization optimization:

    • Screen detergents systematically; DDM (n-dodecyl-β-D-maltopyranoside), LMNG (lauryl maltose neopentyl glycol), and GDN (glyco-diosgenin) typically yield best results

    • Include cholesteryl hemisuccinate (CHS) at 0.1-0.2% to stabilize the receptor

    • Solubilize at 4°C for 2-3 hours with gentle rotation

    • Remove insoluble material by ultracentrifugation (100,000 × g for 45 minutes)

  • Affinity chromatography:

    • Use tandem affinity tags (e.g., His8-FLAG or His6-Twin-Strep) for increased purity

    • Include detergent at concentrations slightly above CMC in all buffers

    • Add lipids (POPC/POPE/cholesterol mixture) in buffers to stabilize the receptor

    • Elute with gentle conditions (imidazole gradient rather than step elution)

  • Size exclusion chromatography:

    • Critical for removing aggregated receptor

    • Run at slow flow rates (0.3-0.5 ml/min) to preserve receptor integrity

    • Collect monodisperse peak fractions for functional studies

  • Stabilization approaches:

    • Addition of putative ligands during purification can stabilize active conformations

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) provide more native-like membrane environments than detergent micelles

Typical yields range from 0.1-0.5 mg of purified receptor per liter of mammalian cell culture, with higher yields possible from specialized expression systems. Functional assessment through ligand-binding assays or activity measurements should be performed immediately after purification to confirm retention of native structure.

What analytical methods best characterize the structural integrity of purified recombinant VN1R1?

Comprehensive characterization of purified recombinant VN1R1 requires a multi-modal analytical approach to assess structural integrity at different levels of organization:

  • Protein homogeneity and aggregation state:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides absolute molecular weight determination in detergent complexes

    • Analytical ultracentrifugation distinguishes between monomeric and oligomeric species

    • Negative-stain electron microscopy offers visual confirmation of sample homogeneity and absence of aggregation

  • Secondary structure assessment:

    • Circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) quantifies α-helical content (expected to be high for a 7TM receptor)

    • Fourier-transform infrared spectroscopy (FTIR) provides complementary secondary structure information, particularly valuable for detergent-solubilized samples

    • Thermal denaturation monitored by CD provides stability assessments

  • Tertiary structure verification:

    • Intrinsic tryptophan fluorescence and quenching studies probe the tertiary fold

    • Limited proteolysis patterns compared between putative native and denatured states

    • Disulfide mapping through mass spectrometry confirms proper disulfide bond formation

  • Ligand binding capability:

    • Microscale thermophoresis (MST) to measure binding of putative ligands

    • Surface plasmon resonance (SPR) for interaction kinetics

    • Fluorescence-based ligand binding assays using environmentally sensitive fluorophores

  • Advanced structural studies:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps solvent-accessible regions

    • Cross-linking mass spectrometry captures spatial relationships between protein domains

    • Cryo-electron microscopy (cryo-EM) for structural characterization if sample quality permits

Representative data from optimal preparations shows:

  • 95% purity by SDS-PAGE and analytical SEC

  • α-helical content of 60-65% by CD spectroscopy

  • Monodisperse behavior in SEC-MALS with minimal aggregation

  • Specific binding to candidate ligands with affinities in the micromolar to nanomolar range

  • Thermal stability with transition temperatures (Tm) of 45-55°C depending on detergent and ligand conditions

These analytical parameters collectively confirm proper folding and structural integrity, essential prerequisites for functional and structural studies of this challenging receptor.

How can recombinant VN1R1 be utilized in high-throughput screening for novel ligands?

Recombinant human VN1R1 provides a valuable platform for identifying novel interacting compounds through high-throughput screening approaches. Optimized methodologies have been developed that balance throughput with sensitivity:

  • Cell-based functional assays:

    • Stable cell lines expressing VN1R1 coupled to reporter systems (calcium flux, β-arrestin recruitment, or cAMP modulation)

    • Miniaturization to 384- or 1536-well formats enables screening of large compound libraries

    • FLIPR (Fluorescent Imaging Plate Reader) allows simultaneous measurement across entire plates

    • Z'-factor optimization through positive controls (if known) or constitutively active receptor mutants

  • Binding assays with purified receptor:

    • Fluorescence polarization with labeled reference compounds

    • Time-resolved FRET (TR-FRET) between receptor and potential ligands

    • Thermal shift assays measuring stabilization upon ligand binding

    • Surface plasmon resonance (SPR) for direct binding measurement

  • Fragment-based approaches:

    • Screening smaller chemical fragments that bind weakly but can be elaborated into higher-affinity ligands

    • NMR-based fragment screening with isotopically-labeled receptor

    • Mass spectrometry to detect fragment binding

  • Virtual screening integration:

    • Homology models of VN1R1 enable in silico screening to prioritize compounds

    • Molecular docking of virtual libraries followed by experimental validation

    • Machine learning algorithms to predict potential binders based on limited known interactions

  • Data analysis pipelines:

    • Dose-response curve generation for hit confirmation

    • Structure-activity relationship analysis for hit expansion

    • Clustering algorithms to identify chemical scaffolds with activity

These screening approaches have identified several chemical classes with potential VN1R1 interactions, though validation of physiological relevance remains challenging. The integration of computational and experimental screening has proven particularly effective for this receptor class where endogenous ligands remain poorly characterized.

What role might VN1R1 play in future research on human chemosensory perception?

The unique evolutionary status of VN1R1 as one of the few potentially functional vomeronasal receptors in humans positions it as a critical target for understanding human chemosensory perception beyond conventional olfaction. Several promising research directions are emerging:

  • Unconscious social chemosignaling:

    • Investigation of VN1R1's potential role in detecting social chemosignals related to emotional state, reproductive status, or kinship

    • Correlation of VN1R1 genetic variants with individual differences in unconscious responses to body odors

    • Neuroimaging studies examining brain activation patterns in response to putative VN1R1 ligands

  • Integration with the main olfactory system:

    • Exploration of how VN1R1 signaling may interact with or complement canonical olfactory receptor pathways

    • Investigation of potential convergence of VN1R1 and olfactory receptor signals in higher brain regions

    • Assessment of whether VN1R1 mediates aspects of olfactory perception that are not consciously accessible

  • Evolutionary models of sensory repurposing:

    • Using VN1R1 as a model to understand how sensory receptors can be functionally repurposed during evolution

    • Comparative studies across primates to identify selective pressures that maintained VN1R1 functionality

    • Investigation of whether VN1R1 represents a case of exaptation, where a trait evolved for one purpose becomes co-opted for another

  • Clinical implications:

    • Exploration of potential correlations between VN1R1 variants and conditions affecting social cognition

    • Investigation of VN1R1's unexpected expression in non-olfactory tissues and potential physiological roles

    • Development of VN1R1-targeted compounds that might modulate specific aspects of chemosensory perception

  • Technological applications:

    • Development of biosensors utilizing recombinant VN1R1 for detecting specific compounds in environmental or biomedical samples

    • Creating sensitive detection systems for human-specific chemosignals with applications in forensics or diagnostics

Future research will likely utilize interdisciplinary approaches combining molecular biology, psychophysics, neuroimaging, and computational modeling to fully elucidate the role of VN1R1 in human chemosensory perception and its broader biological significance.

What emerging technologies might advance our understanding of VN1R1 function?

Cutting-edge technological developments are poised to transform our understanding of VN1R1 function at multiple levels of biological organization:

  • Single-cell multi-omics:

    • Single-cell RNA sequencing to identify specific cell populations expressing VN1R1 with unprecedented resolution

    • Spatial transcriptomics to map VN1R1 expression within complex tissues while preserving spatial context

    • Single-cell proteomics to correlate VN1R1 protein levels with other signaling components

    • Integration of these approaches provides comprehensive cellular context for VN1R1 function

  • Advanced structural biology:

    • Cryo-electron microscopy for high-resolution structural determination of VN1R1 alone and in complex with putative ligands or signaling partners

    • AlphaFold2 and other AI-based structural prediction tools to model VN1R1 conformational states

    • Time-resolved structural methods to capture dynamic aspects of receptor activation

  • Genome editing technologies:

    • CRISPR-Cas9 precise editing to create humanized animal models expressing human VN1R1

    • Creation of knock-in reporter systems to visualize VN1R1 expression in vivo

    • Engineering human organoids with modified VN1R1 genes to study receptor function in complex tissue contexts

  • Advanced imaging:

    • Super-resolution microscopy techniques (STORM, PALM) to visualize VN1R1 distribution and clustering at the nanoscale

    • Multiphoton imaging of calcium signals in VN1R1-expressing cells in tissue preparations

    • Molecular imaging probes for non-invasive tracking of VN1R1 activation in real-time

  • Computational approaches:

    • Molecular dynamics simulations of VN1R1 in membrane environments to understand conformational dynamics

    • Machine learning algorithms to predict ligand-receptor interactions based on limited experimental data

    • Systems biology modeling of VN1R1 signaling networks integrating proteomics and transcriptomics data

  • Synthetic biology tools:

    • Designer receptors exclusively activated by designer drugs (DREADDs) based on VN1R1 to control signaling with temporal precision

    • Synthetic cell systems reconstituting minimal VN1R1 signaling components

    • Bioorthogonal chemistry approaches to track VN1R1 trafficking and turnover

These emerging technologies, particularly when applied in combination, promise to overcome many of the current limitations in studying this challenging receptor system, potentially revealing novel functions and signaling mechanisms that have remained elusive with conventional approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.