Recombinant Human Vomeronasal type-1 receptor 3 (VN1R3)

Shipped with Ice Packs
In Stock

Description

Introduction to Vomeronasal Receptors

Vomeronasal receptors (VRs) represent a specialized class of chemosensory receptors primarily associated with pheromone detection in mammals. These receptors are classified into two major groups: V1Rs and V2Rs, which exhibit distinct structural and functional characteristics . The vomeronasal system has traditionally been considered the primary sensory pathway for pheromone detection, playing critical roles in social and reproductive behaviors across mammalian species.

In humans, the vomeronasal system has undergone significant evolutionary changes. While rodents and many other mammals possess fully functional vomeronasal organs (VNOs) with complete receptor repertoires, humans exhibit a reduced number of functional vomeronasal receptor genes . Notably, only V1Rs are encoded by functional genes in humans, while V2Rs have largely become pseudogenes during primate evolution .

The V1R family consists of several members, including VN1R1, VN1R2, VN1R3, VN1R4, and VN1R5, each with distinct expression patterns and potential functions . These receptors belong to the G protein-coupled receptor (GPCR) superfamily, specifically class A GPCRs, though they exhibit limited sequence homology with other receptors in this class .

Evolutionary Significance of Vomeronasal Receptors

Vomeronasal receptors have undergone substantial evolutionary pressure across mammalian lineages. Research indicates that these receptor genes have been subject to strong positive selection, highlighting their fundamental importance for survival and propagation of species . The evolutionary trajectory of these receptors reflects adaptations to specific ecological niches and social structures.

Vomeronasal Receptor Types and Distribution

Although mammals possess three categories of vomeronasal receptors (V1Rs, V2Rs, and V3Rs), humans retain limited functional capacity in this system. Figure 1 in the literature demonstrates the comparative distribution of vomeronasal receptors between mice and humans, revealing significant reduction in receptor diversity in humans . This reduction likely correlates with decreased reliance on pheromonal communication in human social interactions compared to other mammals.

Expression Pattern

Human VN1R3 exhibits a tissue-specific expression pattern. According to the available research, VN1R3 is primarily expressed in the testis . This expression pattern differs from some other V1R family members such as VN1R1, which shows expression in brain, lung, kidney, and plasma, or VN1R4, which is expressed in both testis and cervix . The testicular expression of VN1R3 suggests potential roles in reproductive physiology, though specific functions remain to be fully characterized.

Table 1: Expression Patterns of Human V1R Family Members

ReceptorExpression SitesAssociated SNPsAssociated TraitsKnown Ligands
VN1R1Brain, lung, kidney, plasmars28649880Sociosexual behavior in womenHedione
VN1R2Brain, adipocytes, testisNot reportedNot reportedNot identified
VN1R3TestisNot reportedNot reportedNot identified
VN1R4Testis, cervixNot reportedNot reportedNot identified
VN1R5Testisrs1578862Monocyte percentageNot identified

G Protein Coupling

VN1R3, as a member of the V1R family, likely couples with specific G protein subunits to initiate downstream signaling cascades. Research on vomeronasal receptors indicates that V1Rs associate with the Gγ2 subunit of heterotrimeric G proteins . This association is critical for transducing the external chemical stimulus into intracellular signaling events.

Signal Transduction Cascade

The binding of a ligand to V1R family receptors, including VN1R3, initiates a signaling cascade that leads to the synthesis of diacylglycerol. This second messenger subsequently induces the opening of transient receptor potential calcium channels, resulting in calcium influx and neuronal depolarization . This mechanism represents the canonical signaling pathway for vomeronasal receptors in species with fully functional vomeronasal systems.

Expression Systems

The production of recombinant VN1R3 represents a significant challenge due to the intrinsic properties of membrane proteins. Based on general approaches for GPCR expression, several expression systems might be employed for VN1R3 production, including bacterial (Escherichia coli), yeast (Pichia pastoris, Saccharomyces cerevisiae), insect cell (Sf9, High Five), or mammalian cell (HEK293, CHO) systems. Each system offers distinct advantages and limitations for membrane protein expression.

Purification Strategies

Purification of recombinant VN1R3 typically involves solubilization with detergents or amphipols, followed by affinity chromatography using tags incorporated into the recombinant construct. Additional purification steps may include size exclusion chromatography or ion exchange chromatography to achieve high purity preparations suitable for structural and functional studies.

Ligand Identification

While specific ligands for VN1R3 have not been reported in the available literature, recombinant receptor expression systems facilitate high-throughput screening approaches for ligand identification. Such systems enable functional assays measuring receptor activation in response to candidate compounds, potentially revealing natural or synthetic ligands for VN1R3.

Tissue-Specific Functions

Given the testicular expression of VN1R3, recombinant protein studies may elucidate potential roles in reproductive physiology. Investigation of receptor function in testicular cell types could reveal involvement in processes such as spermatogenesis, sperm maturation, or local hormonal signaling pathways.

Comparison with Mouse Vomeronasal System

The mouse vomeronasal system provides a well-characterized model for understanding vomeronasal receptor function. In mice, vomeronasal receptors exhibit strict monoallelic expression, with each vomeronasal sensory neuron expressing a single receptor type from the V1R or V2R families . Research focusing on transgenic mouse models has revealed that this expression pattern depends on the genomic context of receptor genes.

Studies using the formyl peptide receptor gene Fpr-rs3, which shares regulatory mechanisms with V1R genes, demonstrated that receptor gene expression is not properly maintained when the gene is removed from its native genomic cluster . When transgenes containing Fpr-rs3 were introduced outside their endogenous genomic context, expression was initiated in young neurons but not maintained in mature neurons . This finding suggests that proper receptor expression requires specific genomic clustering.

Relevance to Human VN1R3 Studies

These findings from mouse models have important implications for understanding human VN1R3 function and recombinant expression. The genomic context and regulatory elements may significantly influence the expression and stability of vomeronasal receptors. When producing recombinant VN1R3, consideration should be given to the potential importance of regulatory elements beyond the coding sequence itself.

Table 2: Comparison of Vomeronasal Receptor Families

CharacteristicV1R Family (including VN1R3)V2R FamilyV3R Family
StructureClass A GPCRsGPCRsSeven-pass transmembrane receptors
Human genesLimited functional genesPseudogenesOne potentially functional gene
Ligand binding siteTransmembrane regionsNot applicable for humansNot specified
G protein couplingGγ2 subunitNot applicable for humansNot specified
Signal transductionDiacylglycerol pathwayNot applicable for humansNot specified
Expression in humansTissue-specific expressionNot expressedLimited expression

Technical Challenges

The production and characterization of recombinant VN1R3 face several technical challenges. As a membrane protein, VN1R3 presents difficulties in expression, solubilization, and purification while maintaining native conformation and function. Additionally, the identification of physiologically relevant ligands remains challenging due to the limited understanding of human vomeronasal system function.

Future Research Directions

Future research on recombinant VN1R3 should focus on:

  1. Development of optimized expression systems for high-yield, functional receptor production

  2. Identification of potential ligands through high-throughput screening approaches

  3. Investigation of tissue-specific functions, particularly in testicular physiology

  4. Exploration of potential roles in human chemosensory perception

  5. Examination of receptor clustering and genomic context effects on expression stability

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VN1R3; V1RL3; FKSG46; Vomeronasal type-1 receptor 3; V1r-like receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VN1R3
Target Protein Sequence
MASKDFAIGMILLSQIMVGFLGNFFLLYHYSFLCFTRGMLQSTDLILKHLTIANSLVILS KGIPQTMAAFGLKDSLSDIGCKFVFYVHRVGRAVCVGNACLLSVFQVITISPSEFRWAEL KLHAHKYIRSFILVLCWILNTLVNITVLLHVTGKWNSINSTKTNDYGYCSGGSRSRIPHS LHIVLLSSLDVLCLGLMTLASGSMVFILHRHKQQVQHIHGTNLSARSSPESRVTQSILVL VSTLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACC GRNPQFPKLVR
Uniprot No.

Target Background

Function
Putative pheromone receptor.
Database Links

HGNC: 19867

KEGG: hsa:317702

UniGene: Hs.257746

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Vomeronasal Type-1 Receptor 3 and how does it differ from other vomeronasal receptors?

The Vomeronasal Type-1 Receptor 3 (VN1R3) belongs to the V1R family of G protein-coupled receptors that are primarily expressed in the vomeronasal organ (VNO). Unlike other vomeronasal receptors, VN1R3 is part of the apical zone receptor population that primarily expresses the G-protein subunit Gαi2 and the co-receptor neuropilin-2 (Nrp-2). These receptors project to the anterior portion of the accessory olfactory bulb (AOB), which distinguishes them from the basal zone V2R receptors that project to different regions of the AOB . The human VN1R3 is of particular interest because it represents one of the few potentially functional vomeronasal receptor genes retained in the human genome, despite the fact that the human vomeronasal organ is considered vestigial.

What are the primary experimental systems used to study recombinant VN1R3?

Researchers typically employ several experimental systems to study recombinant VN1R3:

  • Heterologous expression systems: Human embryonic kidney (HEK293) cells and Chinese hamster ovary (CHO) cells are commonly transfected with VN1R3 expression constructs.

  • Neuronal cell lines: SH-SY5Y or other neuronal-like cell lines can be used to study receptor signaling in a more physiologically relevant context.

  • In vitro reconstitution: Purified receptor protein can be reconstituted into liposomes or nanodiscs for biophysical studies.

  • Transgenic animal models: Though challenging due to species differences, mice expressing human VN1R3 can provide insights into receptor function.

When designing these experiments, researchers must carefully control for background signaling and expression levels, as G protein-coupled receptors can exhibit constitutive activity or undergo ligand-independent signaling when overexpressed .

What methodologies are recommended for confirming proper expression of recombinant VN1R3?

To confirm proper expression of recombinant VN1R3, multiple complementary methodologies should be employed:

  • Western blotting: Using antibodies against either the VN1R3 protein or epitope tags engineered into the recombinant construct.

  • Immunofluorescence microscopy: To visualize cellular localization, ensuring proper membrane trafficking.

  • Surface biotinylation assays: To quantify the proportion of receptor reaching the cell surface.

  • Functional calcium imaging: To verify ligand-induced calcium flux, indicating proper coupling to G proteins.

  • RT-qPCR: To quantify mRNA expression levels.

It is essential to include appropriate positive and negative controls for each method to ensure the reliability of results. Researchers should be aware that membrane proteins like VN1R3 often require specialized conditions for optimal expression, including lower incubation temperatures (30-32°C) and the use of chemical chaperones to promote proper folding 2.

How should researchers design experiments to identify ligands for recombinant human VN1R3?

Designing experiments to identify ligands for recombinant human VN1R3 requires a multifaceted approach:

  • High-throughput screening platforms: Employ calcium imaging or bioluminescence resonance energy transfer (BRET) assays with cells expressing VN1R3 to screen compound libraries.

  • Structural biology approaches: Utilize computational docking studies based on homology models of VN1R3 to predict potential ligand binding.

  • Cross-species comparative analysis: Examine known ligands for rodent V1R receptors as starting points, particularly focusing on those V1Rs phylogenetically closest to human VN1R3.

  • Unbiased metabolomics approaches: Screen human bodily fluids (sweat, tears, urine) using liquid chromatography-mass spectrometry to identify candidate molecules.

For validation experiments, researchers should establish clear concentration-response relationships and demonstrate specificity through competition assays. Control experiments must include cells expressing unrelated receptors to rule out non-specific effects and appropriate vehicle controls to account for solvent effects. The experimental design should also consider the potential for allosteric modulation and the possibility that the receptor may require co-receptors or accessory proteins for proper function 24.

What are the optimal protein expression and purification strategies for structural studies of VN1R3?

Structural studies of VN1R3 present significant challenges due to the inherent properties of G protein-coupled receptors. The following strategies are recommended:

  • Expression systems optimization:

    • Insect cell expression (Sf9, Hi5) using baculovirus

    • Mammalian expression in HEK293S GnTI- cells for reduced glycosylation heterogeneity

    • Cell-free expression systems for direct incorporation into nanodiscs

  • Construct engineering:

    • Fusion partners (T4 lysozyme, BRIL) to stabilize the receptor in specific conformations

    • Thermostabilizing mutations identified through alanine scanning

    • Removal of flexible regions that may impede crystallization

  • Purification strategy:

    • Tandem affinity purification using polyhistidine and FLAG tags

    • Size exclusion chromatography to ensure monodispersity

    • Lipid composition optimization during purification to maintain stability

  • Stabilization approaches:

    • Use of high-affinity ligands or antibody fragments during purification

    • Incorporation into lipid cubic phase for crystallization trials

    • Nanobody co-purification to stabilize specific conformations

Table 1. Comparison of Expression Systems for VN1R3 Structural Studies

Expression SystemAdvantagesDisadvantagesTypical Yield (mg/L)Recommended Detergents
HEK293 cellsNative post-translational modificationsLower yields, expensive0.1-0.5DDM, LMNG, GDN
Sf9/Hi5 cellsModerate yields, scalableDifferent glycosylation pattern0.5-2DDM, LMNG
Yeast (P. pastoris)High yields, inexpensivePotential misfolding1-5DDM, Digitonin
Cell-free systemRapid, direct incorporation into nanodiscsLower yields, expensive0.05-0.2Direct reconstitution

The critical methodological consideration is maintaining receptor stability throughout purification while obtaining sufficient quantities of properly folded protein. Researchers should validate protein functionality through ligand binding assays prior to structural studies 24.

How can researchers address the challenges of data interpretation when studying potentially vestigial human vomeronasal receptors?

When studying potentially vestigial human vomeronasal receptors like VN1R3, researchers face unique challenges in data interpretation that require careful methodological approaches:

  • Evolutionary context analysis:

    • Compare sequence conservation across primates to identify selective pressures

    • Analyze coding region integrity (pseudogenization signatures)

    • Evaluate promoter region functionality through reporter assays

  • Expression validation approaches:

    • Use multiple tissue sources and sensitive detection methods (digital droplet PCR)

    • Distinguish genuine low-level expression from technical artifacts

    • Perform single-cell RNA sequencing to identify specific cell populations expressing the receptor

  • Functional validation strategies:

    • Develop clear positive and negative controls for signaling assays

    • Employ dose-response studies with multiple endpoints (calcium, cAMP, ERK phosphorylation)

    • Use chimeric receptors with known functional domains to isolate specific functionalities

  • Addressing alternative functions:

    • Investigate expression in non-olfactory tissues

    • Explore potential developmental roles distinct from chemosensation

    • Consider potential immune system functions similar to formyl peptide receptors

When interpreting results, researchers should avoid assuming functional equivalence with rodent receptors and should critically evaluate whether observed signals represent physiologically relevant responses or experimental artifacts. The threshold for establishing functionality should include multiple lines of evidence and replication across different experimental systems 4.

What are the key controls required when studying ligand-receptor interactions for VN1R3?

When investigating ligand-receptor interactions for VN1R3, researchers must implement a comprehensive set of controls:

  • Negative controls:

    • Mock-transfected cells (vector only)

    • Cells expressing unrelated GPCRs of similar expression levels

    • Inactive receptor mutants (e.g., DRY motif mutations)

    • Vehicle controls for all test compounds

  • Positive controls:

    • Well-characterized GPCR with known ligand tested in parallel

    • Calcium ionophores or direct G protein activators to confirm signaling capacity

    • Dose-response curves with established receptor-ligand pairs

  • Specificity controls:

    • Competitive binding assays

    • Receptor saturation experiments

    • Cross-desensitization studies

  • System validation controls:

    • Verification of receptor expression levels

    • Demonstration of proper membrane localization

    • Confirmation of G protein coupling capacity

  • Data analysis controls:

    • Blinded scoring procedures

    • Statistical controls for multiple comparisons

    • Normalization to appropriate reference standards

Researchers should be particularly cautious about nonspecific effects caused by high concentrations of test compounds, which may directly activate signaling pathways or alter membrane properties. Additionally, the experimental design should account for the possibility that VN1R3 may respond to complex mixtures rather than single compounds, requiring more sophisticated sampling and analysis approaches 24.

How should researchers optimize transfection conditions for functional studies of recombinant VN1R3?

Optimizing transfection conditions for functional studies of recombinant VN1R3 requires systematic evaluation of multiple parameters:

  • Vector design optimization:

    • Promoter selection (CMV vs. EF1α for sustained expression)

    • Codon optimization for human expression

    • Inclusion of export signal sequences (e.g., rhodopsin N-terminus)

    • Addition of stabilizing elements in 5' and 3' UTRs

  • Cell line selection criteria:

    • Endogenous G protein expression profile

    • Membrane composition compatibility

    • Growth characteristics and transfection efficiency

    • Background receptor expression

  • Transfection parameters:

    • Reagent selection based on cell type (lipid-based vs. electroporation)

    • DNA:reagent ratio optimization

    • Timing of expression analysis (24-72 hours post-transfection)

    • Co-transfection with signaling components (G proteins, arrestins)

  • Culture condition modifications:

    • Reduced temperature incubation (30-32°C) during expression

    • Addition of chemical chaperones (DMSO, glycerol, 4-PBA)

    • Sodium butyrate treatment to enhance expression

    • Specialized media formulations

Table 2. Optimization Matrix for VN1R3 Expression in Different Cell Lines

ParameterHEK293TCHO-K1Neuro2ARecommendations
Optimal DNA amount0.5-1 μg/well (6-well)1-2 μg/well (6-well)0.25-0.5 μg/well (6-well)Titrate for each experiment
Best transfection reagentLipofectamine 3000FuGENE HDLipofectamine 2000Compare 2-3 reagents
Expression time24-48 hours48-72 hours36-60 hoursMonitor time course
Recommended temperature37°C for 24h, then 32°C37°C throughout37°C for 24h, then 30°CTest different schemes
G protein co-expressionGαi2 + Gβ1 + Gγ2Gαi1/2/3 + Gβ1 + Gγ2Endogenous sufficientWestern blot verification

Researchers should develop a systematic optimization protocol, testing each parameter independently while keeping others constant. Surface expression should be quantified using cell-surface ELISA or flow cytometry, while functional capacity should be assessed using appropriate signaling assays 2.

What methods are effective for analyzing the interaction between VN1R3 and downstream signaling components?

Analyzing interactions between VN1R3 and downstream signaling components requires specialized approaches that can capture both direct physical interactions and functional coupling:

  • Direct interaction assays:

    • Co-immunoprecipitation of VN1R3 with G proteins

    • Proximity ligation assay for detecting protein-protein interactions in situ

    • BRET/FRET-based interaction studies with fluorescently tagged proteins

    • Surface plasmon resonance with purified components

    • Cross-linking followed by mass spectrometry identification

  • Functional coupling assays:

    • [35S]GTPγS binding assays to measure G protein activation

    • Real-time cAMP or calcium measurements using biosensors

    • Phosphorylation of downstream effectors (ERK1/2, AKT)

    • Transcriptional reporter assays (CRE, SRE, NFAT)

    • Electrophysiological recordings in co-expression systems

  • Pathway delineation approaches:

    • Pharmacological inhibitors of specific pathway components

    • siRNA knockdown of candidate signaling molecules

    • CRISPR/Cas9 knockout of pathway components

    • Biased ligand screening to identify pathway-selective activation

  • Temporal resolution methods:

    • Single-cell calcium imaging with high temporal resolution

    • FRET-based conformational sensors to measure receptor activation kinetics

    • Time-resolved phosphoproteomic analysis after receptor stimulation

When interpreting results, researchers should consider the possibility of cell-type specific signaling outcomes, constitutive activity of the receptor, and the potential for signal compartmentalization within the cell. Quantitative analysis should include both the magnitude and kinetics of the response, with appropriate statistical approaches for comparing multiple conditions 24.

How should researchers address data contradictions when studying VN1R3 expression across different human tissues?

When faced with contradictory data regarding VN1R3 expression across different human tissues, researchers should implement a systematic approach to reconcile discrepancies:

  • Technical validation:

    • Compare detection methodologies (qPCR, RNA-seq, in situ hybridization)

    • Validate primers/probes against positive and negative controls

    • Perform absolute quantification using digital PCR

    • Assess RNA quality metrics from each source

  • Biological context analysis:

    • Consider developmental timing of samples

    • Evaluate tissue heterogeneity and cell-type specific expression

    • Assess potential environmental or physiological influences

    • Compare with expression patterns of related genes

  • Meta-analysis approaches:

    • Systematically review published datasets with transparent inclusion criteria

    • Perform statistical pooling of compatible data

    • Weight studies based on methodological quality

    • Identify patterns in discrepancies (e.g., methodological clusters)

  • Resolution strategies:

    • Design definitive experiments targeting specific discrepancies

    • Employ complementary methods on identical samples

    • Collaborate with laboratories reporting contradictory results

    • Consider single-cell approaches to resolve tissue heterogeneity

Table 3. Comparison of VN1R3 Detection Methods and Their Limitations

Detection MethodSensitivitySpecificityCommon ArtifactsRecommended Validation
RT-PCRHighModerateGenomic DNA contaminationDNase treatment, intron-spanning primers
qPCRVery highHighPrimer dimers, inefficient amplificationStandard curves, melt curves, multiple reference genes
RNA-seqModerate-highHighMapping artifacts, batch effectsRT-qPCR validation, spike-in controls
In situ hybridizationModerateHighBackground staining, probe cross-reactivitySense probes, competing oligonucleotides
ImmunohistochemistryModerateVariableAntibody cross-reactivity, autofluorescencePeptide competition, knockout controls

When reporting findings, researchers should explicitly acknowledge contradictions in the literature, clearly describe methodological differences that might explain discrepancies, and avoid overgeneralizing from limited datasets. The goal should be to develop a nuanced understanding of VN1R3 expression patterns rather than forcing a simplified consensus 4.

What bioinformatic approaches can be used to predict potential ligands for recombinant human VN1R3?

Bioinformatic approaches for predicting potential ligands for recombinant human VN1R3 involve multiple computational strategies:

  • Homology-based approaches:

    • Sequence alignment with functionally characterized vomeronasal receptors across species

    • Phylogenetic analysis to identify closest functional homologs

    • Ligand prediction based on conservation of binding pocket residues

    • Ancestral sequence reconstruction to identify conserved binding properties

  • Structural modeling techniques:

    • Homology modeling based on crystal structures of related GPCRs

    • Molecular dynamics simulations to identify stable binding pocket conformations

    • Virtual screening of compound libraries against predicted binding sites

    • Pharmacophore modeling based on known ligands of related receptors

  • Machine learning methods:

    • Training classifiers on known GPCR-ligand pairs

    • Feature extraction from physicochemical properties of ligands

    • Network-based approaches connecting receptors and potential ligands

    • Deep learning models integrating multiple data types

  • Systems biology integration:

    • Analysis of co-expression patterns with metabolic enzymes

    • Pathway analysis to identify plausible endogenous ligands

    • Evolutionary analysis of receptor-ligand co-evolution

    • Multi-omics data integration to prioritize candidate ligands

For validation, researchers should select diverse candidates from top predictions for experimental testing, implement negative controls (compounds predicted not to bind), and compare predictions from multiple algorithms. It is important to recognize that computational predictions provide hypotheses for experimental testing rather than definitive answers. The confidence in predictions should be weighted based on the available structural information and the degree of evolutionary conservation 4.

How can researchers distinguish between specific and non-specific effects in VN1R3 functional assays?

Distinguishing between specific and non-specific effects in VN1R3 functional assays requires rigorous experimental design and careful analysis:

  • Concentration-dependence analysis:

    • Establish full dose-response curves (10-12 to 10-4 M when possible)

    • Calculate EC50/IC50 values and compare with known ligands

    • Evaluate response profiles for characteristic sigmoid shapes

    • Assess maximum response relative to positive controls

  • Specificity controls:

    • Test responses in non-transfected cells

    • Evaluate cells expressing structurally unrelated receptors

    • Include point mutants of key binding residues in VN1R3

    • Perform heterologous competition assays

  • Signal transduction validation:

    • Block specific pathways with targeted inhibitors

    • Confirm involvement of expected G proteins

    • Assess multiple downstream readouts (calcium, cAMP, ERK)

    • Use bias plots to compare signaling fingerprints

  • Statistical approaches:

    • Apply appropriate multiple testing corrections

    • Implement randomization in experimental design

    • Use blinded analysis of results when possible

    • Calculate signal-to-background ratios and Z-factors

Table 4. Decision Matrix for Evaluating VN1R3 Ligand Specificity

ObservationSupporting SpecificitySuggesting Non-specificityFurther Validation
Dose-responseClear sigmoid curve with reasonable EC50Linear response or very high EC50 (>10 μM)Test structurally related compounds
Receptor dependenceNo response in mock-transfected cellsSimilar response in control cellsTest receptor point mutants
Structure-activityClear relationship among analogsActivity unrelated to structureCompetitive binding assays
G protein dependenceBlocked by pertussis toxin (for Gi coupling)Persists with G protein inhibitorsUse dominant negative G proteins
Calcium responseReduced in calcium-free medium + EGTAOccurs even in calcium-free conditionsTest with thapsigargin pre-treatment

Researchers should be particularly cautious about compounds that alter membrane properties, activate endogenous receptors, or cause cellular stress responses. When reporting results, both positive and negative controls should be clearly presented, and limitations in distinguishing specific from non-specific effects should be explicitly acknowledged 24.

What approaches can be used to study the potential role of VN1R3 in non-olfactory tissues?

Investigating the potential roles of VN1R3 in non-olfactory tissues requires specialized approaches to address the challenges of studying receptors outside their canonical context:

  • Expression profiling strategies:

    • Comprehensive tissue RNA-seq analysis with high depth sequencing

    • Single-cell RNA-seq to identify specific expressing cell populations

    • Spatial transcriptomics to map expression within complex tissues

    • Sensitive in situ hybridization techniques (RNAscope, FISH)

  • Functional characterization methods:

    • Tissue-specific conditional knockout models

    • Inducible expression systems in relevant cell types

    • Physiological phenotyping with tissue-specific readouts

    • Ex vivo tissue preparations with pharmacological interventions

  • Signaling pathway analysis:

    • Phosphoproteomic analysis of tissues expressing VN1R3

    • Transcriptional profiling after receptor modulation

    • Metabolomic analysis to identify biochemical consequences

    • Cell-type specific signaling reporters in vivo

  • Evolutionary and comparative approaches:

    • Cross-species comparison of non-olfactory expression

    • Analysis of selection pressures on receptor domains

    • Examination of gene regulatory elements for tissue-specific control

    • Paralog analysis to identify specialized functions

When designing these studies, researchers should consider the possibility that VN1R3 may have distinct ligands or functions in different tissues, potentially forming heteromeric complexes with other receptors or utilizing different signaling pathways. The threshold for establishing physiologically relevant functions should be higher than for canonical roles, requiring multiple complementary lines of evidence .

How can researchers evaluate the potential clinical significance of VN1R3 polymorphisms in human populations?

Evaluating the potential clinical significance of VN1R3 polymorphisms in human populations requires a multidisciplinary approach:

  • Genetic epidemiology methods:

    • Genome-wide association studies linking VN1R3 variants to phenotypes

    • Targeted sequencing in selected clinical populations

    • Population genetics analysis of selection signatures

    • Family-based studies of rare variants with Mendelian patterns

  • Functional validation approaches:

    • Site-directed mutagenesis to recreate polymorphisms in expression systems

    • Comparative signaling assays of variant receptors

    • Structural modeling to predict impact on ligand binding or G protein coupling

    • Patient-derived cell models (iPSCs differentiated to relevant lineages)

  • Clinical correlation strategies:

    • Detailed phenotyping of individuals with specific variants

    • Biomarker analysis correlated with genotype

    • Longitudinal studies tracking phenotype development

    • Response to relevant therapeutic interventions

  • Bioinformatic prediction methods:

    • Pathogenicity prediction algorithms (SIFT, PolyPhen, etc.)

    • Conservation analysis across species

    • Protein stability predictions

    • Splicing impact predictions for intronic variants

Table 5. Framework for Assessing VN1R3 Variant Significance

Evidence TypeStrong EvidenceSupporting EvidenceNeutral/Negative Evidence
Population dataSignificant association with phenotype, low frequency in controlsEnrichment in specific populations, moderate frequency differenceCommon variant with similar frequency across populations
Functional impactAltered signaling, trafficking, or ligand bindingModest changes in receptor properties, context-dependent effectsNo detectable functional difference from wild-type
Clinical correlationConsistent phenotype in carriers, family co-segregationVariable penetrance, presence in some unaffected individualsNo consistent clinical pattern among carriers
Predictive algorithmsMultiple tools predict damaging impact, affects conserved residuesMixed predictions, moderate conservationPredicted benign, poor conservation

Researchers should be cautious about overinterpreting the significance of variants in a receptor with incompletely understood function in humans. Reports should clearly distinguish between variants with established functional consequences and those with statistical associations only. Collaboration between basic scientists, clinicians, and genetic epidemiologists is essential for meaningful progress in this area 4.

What methodological approaches can address the challenges of studying ligand-receptor interactions for potentially vestigial receptors like VN1R3?

Studying ligand-receptor interactions for potentially vestigial receptors like VN1R3 presents unique methodological challenges that require specialized approaches:

  • Ultra-sensitive detection systems:

    • CRISPR-based transcriptional activation reporter systems

    • Amplified luminescence proximity homogeneous assays

    • Single-molecule imaging of receptor conformational changes

    • Nanobody-based sensors of receptor activation states

  • Alternative expression systems:

    • Axolotl oocytes for low background noise

    • Reconstituted minimal cellular systems

    • Yeast-based platforms optimized for mammalian GPCRs

    • Cell-free expression systems with direct incorporation into membranes

  • Directed evolution strategies:

    • Yeast display evolution of enhanced receptor variants

    • Compartmentalized self-replication to select functional variants

    • Ancestral sequence reconstruction to identify functional predecessors

    • Computational design of stabilized receptors maintaining binding properties

  • Comparative approaches:

    • Cross-species functional analysis with orthologous receptors

    • Chimeric receptors combining domains from functional homologs

    • Rescue experiments in model organisms with receptor knockouts

    • Paralogue substitution scanning to identify critical residues

When interpreting results, researchers should develop clear criteria for distinguishing between residual activity of vestigial receptors and experimentally meaningful function. Positive controls should include receptors with established functions, and thresholds for declaring functionality should be justified based on quantifiable parameters. The experimental design should account for the possibility that vestigial receptors may retain structural features necessary for proper folding but lack key residues for specific ligand recognition or signaling 4.

What are the most promising research directions for understanding the evolutionary significance of VN1R3 retention in humans?

Understanding the evolutionary significance of VN1R3 retention in humans represents a complex research challenge that can be approached through several promising directions:

  • Comparative genomic analysis:

    • Detailed analysis of selection pressures across primate lineages

    • Investigation of regulatory element conservation

    • Identification of co-evolving genes that might reveal functional networks

    • Examination of copy number variations across populations

  • Non-canonical function exploration:

    • Investigation of potential immune system roles

    • Analysis of developmental expression patterns

    • Examination of potential endocrine or metabolic functions

    • Exploration of neurological functions outside olfaction

  • Cultural and environmental adaptation studies:

    • Cross-cultural genetic analysis correlating with environmental factors

    • Analysis of population-specific variants in different geographic regions

    • Investigation of selection signatures in populations with different ancestries

    • Correlation with historical patterns of human migration and adaptation

  • Integrative evolutionary approaches:

    • Reconstruction of ancestral receptor function through paleogenomics

    • Molecular clock analysis to date functional transitions

    • Simulation of evolutionary trajectories under different selection models

    • Comparative analysis with other sensory receptor genes showing similar patterns

The most robust research approaches will combine computational predictions with experimental validation, integrate data across multiple levels (from molecules to populations), and consider both adaptive and neutral models of evolution. Researchers should be particularly attentive to the possibility that VN1R3 may have been repurposed for functions distinct from its ancestral role, potentially explaining its retention despite the vestigiality of the vomeronasal organ in humans .

How can researchers develop more physiologically relevant models for studying human VN1R3 function?

Developing physiologically relevant models for studying human VN1R3 function requires creative approaches to overcome the challenges of studying a potentially vestigial receptor:

  • Advanced cellular models:

    • Human induced pluripotent stem cells differentiated into relevant lineages

    • Organoid systems recapitulating tissue architecture

    • Microfluidic systems mimicking physiological conditions

    • Co-culture systems incorporating multiple cell types

  • Humanized animal models:

    • Transgenic mice expressing human VN1R3 under native regulatory elements

    • Knock-in models replacing mouse V1R with human VN1R3

    • Conditional expression systems for tissue-specific activation

    • Reporter-coupled receptor systems for in vivo activation monitoring

  • Ex vivo human tissue approaches:

    • Primary tissue explants with viral delivery of receptor constructs

    • Patient-derived xenografts expressing modified receptors

    • Precision-cut tissue slices with pharmacological manipulations

    • Bioengineered human tissue constructs

  • Computational and virtual models:

    • Multiscale modeling integrating molecular dynamics with tissue-level simulations

    • Machine learning models trained on existing receptor-response datasets

    • Network pharmacology approaches to predict system-level impacts

    • Virtual patient cohorts for simulating population-level effects

When developing these models, researchers should prioritize validation against known physiological parameters, incorporate appropriate complexity while maintaining experimental control, and explicitly address the limitations of each model system. Importantly, researchers should consider that the most physiologically relevant model may differ depending on whether VN1R3 maintains its ancestral chemosensory function or has been repurposed for other roles in humans 24.

What methodological innovations are needed to advance our understanding of VN1R3 signaling mechanisms?

Advancing our understanding of VN1R3 signaling mechanisms will require methodological innovations across multiple research domains:

  • Real-time signaling dynamics techniques:

    • Development of VN1R3-specific conformational biosensors

    • Spatiotemporal resolution of signaling using optogenetic approaches

    • Single-molecule tracking of receptor-effector interactions

    • Nanoscale organization analysis using super-resolution microscopy

  • Structural biology advancements:

    • Cryo-EM structures of VN1R3 in different activation states

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Solution NMR techniques for membrane protein dynamics

    • Integration of experimental and computational structural approaches

  • Systems biology integration:

    • Multi-omics approaches linking receptor activation to cellular outcomes

    • Network analysis of signaling pathways with temporal resolution

    • Computational models of receptor signaling incorporating stochasticity

    • Machine learning approaches for predicting signaling outcomes

  • Innovative functional genomics approaches:

    • CRISPR screening for signaling components and modulators

    • Synthetic biology platforms for reconstituting signaling pathways

    • Multiplexed reporter systems for simultaneous pathway monitoring

    • Genetic compensation analysis using paralog depletion

Table 6. Emerging Technologies with Potential Applications to VN1R3 Research

TechnologyCurrent LimitationsPotential ImpactImplementation Timeline
Cryo-EM for GPCRsSize limitations, conformational heterogeneityStructural basis for ligand recognition2-5 years
Spatial transcriptomicsResolution, sensitivity for low-expression genesPrecise mapping of expression patterns1-3 years
Deep mutational scanningThroughput, functional readoutsComprehensive structure-function maps1-2 years
Optogenetic GPCR toolsSpecificity, physiological relevancePrecise temporal control of signaling1-3 years
AI-driven ligand discoveryTraining data limitations, validation challengesAccelerated identification of ligands2-4 years

To maximize progress, researchers should pursue collaborative approaches that integrate methodologies across disciplines, develop standardized assay systems to enable data comparison across laboratories, and establish open data-sharing platforms for this specialized research area. The most impactful innovations will likely combine advances in basic technology with specific adaptations for the unique challenges presented by potentially vestigial receptors 24.

What are the recommended protocols for generating stable cell lines expressing recombinant human VN1R3?

Generating stable cell lines expressing recombinant human VN1R3 requires careful consideration of receptor biology and expression system characteristics. The following protocol framework addresses key methodological considerations:

  • Vector design considerations:

    • Use mammalian expression vectors with strong promoters (CMV or EF1α)

    • Include codon-optimized VN1R3 sequence for human expression

    • Consider N-terminal signal sequences to enhance membrane targeting

    • Add C-terminal epitope tags (FLAG, HA) for detection with minimal interference

    • Include selection marker appropriate for host cells (puromycin, G418, blasticidin)

  • Cell line selection factors:

    • HEK293T cells for high transfection efficiency and expression

    • CHO-K1 cells for stable glycosylation patterns and low background

    • Neuro2A cells for neuron-relevant cellular context

    • U2OS cells for high-content imaging applications

  • Stable integration methods:

    • Transfection-selection approach:

      • Optimize transfection using lipid-based reagents or electroporation

      • Begin selection 24-48 hours post-transfection

      • Use lowest effective antibiotic concentration determined by kill curve

      • Isolate single colonies using cloning rings or limiting dilution

      • Screen 20-30 colonies for expression level and receptor localization

    • Lentiviral transduction approach:

      • Generate lentivirus in packaging cells (HEK293T)

      • Determine viral titer using qPCR or reporter assays

      • Transduce target cells at low MOI (0.1-0.3) to ensure single integration

      • Select with appropriate antibiotic for 10-14 days

      • Isolate clones and verify integration by PCR

  • Verification and validation:

    • Confirm VN1R3 expression by Western blot and immunofluorescence

    • Verify membrane localization using surface biotinylation

    • Assess functional coupling using calcium mobilization assays

    • Ensure stable expression over multiple passages (at least 10)

    • Cryopreserve early passage cells for future experiments

The key to success is rigorous quality control at each step, particularly verification of proper receptor trafficking to the plasma membrane. Researchers should be prepared to screen numerous clones, as GPCR expression can vary dramatically between individual cell clones due to integration effects and receptor-induced cellular adaptations 24.

What are the best practices for designing and interpreting calcium mobilization assays for VN1R3?

Calcium mobilization assays are commonly used to assess GPCR functionality, but require careful design and interpretation when applied to potentially vestigial receptors like VN1R3:

  • Assay design considerations:

    • Indicator selection:

      • Fluorescent dyes (Fluo-4, Fura-2) for population measurements

      • Genetically encoded calcium indicators (GCaMP variants) for single-cell resolution

      • Ratiometric indicators (Fura-2, Indo-1) to control for cell density and loading

    • Cell preparation protocol:

      • Plate cells 24-48 hours before assay at 70-80% confluence

      • For adherent cells, use poly-D-lysine coated plates to prevent detachment

      • Load dyes at appropriate concentration and temperature (typically 37°C)

      • Include proper washing steps to remove extracellular dye

    • Instrument setup:

      • Plate readers for population measurements (FLIPR, FlexStation)

      • Fluorescence microscopy for single-cell resolution

      • Flow cytometry for high-throughput single-cell analysis

      • Confocal systems for subcellular calcium dynamics

  • Experimental controls:

    • Positive controls:

      • Ionomycin (1-5 μM) as maximal response control

      • ATP (10 μM) to verify endogenous P2Y receptor function

      • Carbachol for cells with muscarinic receptors

    • Negative controls:

      • Vehicle controls matching test compound solvents

      • Non-transfected cells or cells expressing unrelated receptors

      • Buffer-only additions to assess mechanical stimulation artifacts

  • Data analysis approaches:

    • Normalization methods:

      • Percent of maximum ionomycin response

      • Fold change over baseline

      • ΔF/F0 for fluorescent indicators

      • Ratio calculation for ratiometric dyes

    • Quantification parameters:

      • Peak height (amplitude)

      • Area under curve (integrated response)

      • Time to peak (kinetics)

      • Response duration (signaling persistence)

  • Interpretation guidelines:

    • Establish clear threshold criteria for positive responses

    • Analyze concentration-dependence relationships

    • Consider cell-to-cell variability in single-cell measurements

    • Assess reproducibility across independent experiments

Table 7. Troubleshooting Guide for VN1R3 Calcium Assays

ProblemPossible CausesSolutions
No response to positive controlsPoor cell viability, inadequate dye loadingCheck cell health, optimize dye concentration and loading time
High background signalSpontaneous calcium oscillations, mechanical sensitivitySerum-starve cells, use automated liquid handling
Poor signal-to-noise ratioLow receptor expression, inefficient couplingVerify expression levels, co-express relevant G proteins
Non-specific responsesSolvent effects, osmotic changesUse highly purified compounds, maintain consistent osmolarity
Variable responses between wellsUneven cell distribution, temperature gradientsImprove cell plating, equilibrate plates before reading

When interpreting results, researchers should be particularly cautious about declaring a compound as a "ligand" based solely on calcium responses, as multiple mechanisms can lead to calcium mobilization. Confirmation through orthogonal assays (cAMP, ERK phosphorylation, β-arrestin recruitment) is strongly recommended 24.

How can researchers effectively share and reproduce complex protocols for VN1R3 research?

Effective sharing and reproduction of complex protocols for VN1R3 research requires structured approaches to documentation, validation, and dissemination:

  • Comprehensive protocol documentation:

    • Structured format elements:

      • Clear delineation of materials, methods, and expected outcomes

      • Step-by-step procedures with precise timing information

      • Detailed recipes for all buffers and solutions

      • Equipment specifications including model numbers and settings

      • Validation criteria and troubleshooting guidelines

    • Critical parameters identification:

      • Highlight steps where precision is essential

      • Specify acceptable ranges for variable parameters

      • Note temperature or time-sensitive steps

      • Include visual guides for complex manipulations

  • Validation and quality control:

    • Internal validation approaches:

      • Have protocols tested by researchers not involved in development

      • Document batch-to-batch variability in key reagents

      • Establish minimum performance criteria for each protocol stage

      • Develop positive controls that verify protocol success

    • External validation mechanisms:

      • Collaborate with independent laboratories for protocol testing

      • Document protocol performance across different equipment platforms

      • Establish round-robin testing for critical methodologies

      • Create standardized reference materials when possible

  • Effective dissemination strategies:

    • Publication approaches:

      • Publish in journals specializing in methodological advances

      • Utilize protocol-specific repositories (Protocol Exchange, Bio-protocol)

      • Consider video journals for complex technical procedures

      • Deposit protocols in community resources like Addgene or ATCC

    • Digital documentation methods:

      • Create interactive electronic protocols with decision trees

      • Develop video demonstrations of critical steps

      • Establish GitHub repositories for protocol versions and updates

      • Implement electronic lab notebooks with shareable protocol templates

  • Reproducibility enhancement:

    • Resource sharing:

      • Deposit cell lines in repositories with quality control data

      • Share plasmids through Addgene with sequence verification

      • Provide detailed provenance information for key reagents

      • Establish material transfer agreements that permit protocol modification

    • Data reporting standards:

      • Include raw data alongside processed results

      • Document computational analysis with preserved code

      • Report all failed attempts and optimization steps

      • Maintain transparency about limitations and failures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.