Recombinant Human Vomeronasal type-1 receptor 5 (VN1R5)

Shipped with Ice Packs
In Stock

Description

Role in Cisplatin Resistance

VN1R5 is implicated in chemoresistance mechanisms, particularly in head and neck squamous cell carcinoma (HNSCC):

MechanismFindingsSource
Upstream RegulationVN1R5 expression is induced in cisplatin-resistant HNSCC cells/tissues
Downstream TargetTranscriptionally regulates lnc-POP1-1 via Sp1/cAMP-PKA signaling
Functional ImpactEnhances DNA repair by stabilizing MCM5 protein, reducing ubiquitination

Key Study: VN1R5 knockout in cisplatin-resistant HNSCC cells reduced IC50 values and colony formation under cisplatin treatment, while overexpression increased resistance .

Interaction with Long Noncoding RNAs

Recombinant VN1R5 enables detailed studies of its regulatory partnerships:

Partner MoleculeInteractionFunctional OutcomeSource
lnc-POP1-1Direct transcriptional activationPromotes DNA repair and chemoresistance
MCM5Indirect stabilization via lnc-POP1-1Inhibits MCM5 degradation

Recombinant VN1R5 Production and Validation

Commercial recombinant VN1R5 is produced in bacterial systems, with quality controlled via:

ParameterSpecificationApplicationSource
Expression SystemE. coliStructural/functional studies
PurityHigh-purity recombinant proteinBinding assays, signaling studies
ValidationWestern blot, mass spectrometryConfirming protein integrity

Note: Native VN1R5 is difficult to isolate due to its membrane-bound nature; recombinant versions overcome this limitation .

Clinical and Therapeutic Relevance

Recombinant VN1R5 serves as a tool for developing targeted therapies:

Potential UseRationaleEvidenceSource
Biomarker DevelopmentHigh expression in cisplatin-resistant HNSCC tissues predicts poor prognosis5-year survival rates inversely correlate with VN1R5 levels
Therapeutic TargetingInhibiting VN1R5-lnc-POP1-1 axis may reverse chemoresistanceKnockdown experiments restore cisplatin sensitivity

Table 2: Recombinant VN1R5 Production Parameters

ParameterDetail
SourceE. coli in vitro expression
ApplicationsFunctional assays, antibody validation, signaling pathway studies
Purity>90% (typical for commercial recombinant proteins)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your requested tag.
Synonyms
VN1R5; V1RL5; Vomeronasal type-1 receptor 5; G-protein coupled receptor GPCR26; hGPCR26; V1r-like receptor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VN1R5
Target Protein Sequence
MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISAN TILLLFHIFTFVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKV IVFLNKVMRGLSICTPCLLSVLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGV IFCCTLRLPPVKRGQSSVCHTALFLFAHELHPQETVFHTNDFEGCHLYRVHGPLKRLHGD YFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFTYWVDFTFSFSGGVTWINDSL LVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNRQCGSTKK
Uniprot No.

Target Background

Function
This protein is a putative pheromone receptor.
Database Links

HGNC: 19870

KEGG: hsa:317705

UniGene: Hs.553686

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Vomeronasal Type-1 Receptor 5 (VN1R5) and how is it characterized?

VN1R5 is a protein encoded by the VN1R5 gene in humans, classified as one of five remnant vomeronasal type-1 receptor genes in the human genome . The full-length protein consists of 357 amino acids and is structurally characterized as a G-protein coupled receptor (GPCR) . While traditionally associated with pheromone detection in animals, human VN1R5's biological function remains somewhat elusive. The protein has numerous synonyms in scientific literature, including V1RL5, G-protein coupled receptor GPCR26, V1R-like 5, and pheromone receptor, reflecting its evolutionary relationship to vomeronasal receptors in other species .

To characterize VN1R5 experimentally, researchers typically use recombinant expression systems with epitope tags (such as His-tags) to facilitate detection and purification. Available recombinant forms include full-length human VN1R5 expressed in E. coli systems, as well as orthologous proteins from other primates such as western lowland gorilla for comparative studies .

How does human VN1R5 differ functionally from rodent vomeronasal receptors?

Human VN1R5 exhibits several key functional differences from rodent vomeronasal receptors, particularly regarding signaling mechanisms and ligand specificity. Unlike mouse V1rb2, which responds to picomolar concentrations of the mouse pheromone 2-heptanone, human VN1R5 responds to a broader range of odorants, particularly C9-C10 aliphatic alcohols and aldehydes at submicromolar concentrations .

The most striking difference lies in the signal transduction pathway. When expressed in HeLa/Olf cells, human VN1R5 activates cAMP signaling via G protein αolf, contrasting with the phospholipase C-dependent pathways typical of rodent vomeronasal receptors . This suggests that despite structural similarities, human VN1R5 has evolved different functional characteristics more akin to odorant receptors than traditional pheromone receptors .

These differences may reflect the evolutionary reduction of the vomeronasal system in humans, with the remnant receptors potentially being repurposed for other functions beyond classical pheromone detection.

What are the recommended expression systems for studying recombinant VN1R5?

For functional studies of recombinant VN1R5, the HeLa/Olf cell system has proven effective. This system involves HeLa cells stably expressing the olfactory G protein αolf, which couples effectively with VN1R5 to activate cAMP signaling pathways . When expressed in this system, N-terminally tagged VN1R5 localizes appropriately to the plasma membrane and maintains responsiveness to relevant ligands .

For protein production, E. coli-based expression systems have been successfully employed to generate recombinant full-length VN1R5 with His-tags for purification purposes . The expression construct design should consider the 357-amino acid sequence to ensure proper folding and functionality.

For researchers conducting structure-function analyses, both mammalian and bacterial expression systems offer complementary advantages - mammalian systems provide appropriate post-translational modifications and membrane integration for functional studies, while bacterial systems typically yield higher protein quantities for biochemical and structural investigations.

How does VN1R5 contribute to cisplatin resistance in head and neck squamous cell carcinoma (HNSCC)?

VN1R5 has been identified as a critical mediator of cisplatin resistance in HNSCC through a complex signaling cascade involving long non-coding RNA regulation and DNA repair mechanisms . Mass spectrometry analyses revealed significant upregulation of VN1R5 in cisplatin-resistant HNSCC cell lines (HN4/DDP and HN30/DDP) compared to their cisplatin-sensitive counterparts . This observation was further validated in clinical samples, where VN1R5 expression was significantly higher in tissues from patients resistant to the TPF (docetaxel+cisplatin+5-fluorouracil) chemotherapy regimen .

Mechanistically, VN1R5 activates the cAMP/PKA pathway, which subsequently phosphorylates the transcription factor Sp1 . Phosphorylated Sp1 binds to the promoter region of lnc-POP1-1, upregulating its expression . lnc-POP1-1 then binds directly to the minichromosome maintenance deficient 5 (MCM5) protein, inhibiting its ubiquitination and subsequent degradation . The stabilized MCM5 enhances DNA repair capability, allowing cancer cells to overcome cisplatin-induced DNA damage .

Experimental knockout of VN1R5 using CRISPR-Cas9 technology significantly reduced the IC50 values for cisplatin and decreased colony formation in resistant cell lines, while VN1R5 overexpression in sensitive cell lines had the opposite effect, both in vitro and in xenograft models .

What molecular mechanisms underlie VN1R5 signaling in different cellular contexts?

VN1R5 exhibits context-dependent signaling mechanisms that vary between neuronal/sensory systems and cancer cells. In the HeLa/Olf expression system, VN1R5 couples to G protein αolf to activate adenylyl cyclase, leading to increased intracellular cAMP levels . This signaling pathway differs from the canonical vomeronasal receptor signaling in rodents, which typically involves phospholipase C activation.

In cancer cells, particularly HNSCC, VN1R5 activates the cAMP/PKA pathway, leading to the phosphorylation of transcription factor Sp1 at threonine 453 . This phosphorylation enhances Sp1's transcriptional activity, particularly at the promoter region of lnc-POP1-1 . The signaling pathway appears to be linear: VN1R5 → cAMP elevation → PKA activation → Sp1 phosphorylation → lnc-POP1-1 transcription .

The differential signaling outcomes in sensory versus cancer contexts suggest that VN1R5 may interact with distinct downstream effectors depending on the cellular environment and available signaling components. This context-dependent signaling versatility represents an important area for further investigation, particularly regarding potential tissue-specific cofactors that may modulate VN1R5 signaling outcomes.

What is the relationship between VN1R5, lnc-POP1-1, and MCM5 in DNA repair pathways?

The VN1R5/lnc-POP1-1/MCM5 axis forms a regulatory pathway that enhances DNA repair capacity in cisplatin-resistant HNSCC cells . Within this pathway, VN1R5 acts as the upstream initiator, activating the cAMP/PKA pathway which phosphorylates the transcription factor Sp1 . Phosphorylated Sp1 then binds to the promoter region of lnc-POP1-1, upregulating its expression .

The long non-coding RNA lnc-POP1-1 directly interacts with the MCM5 protein, which is a critical component of the DNA replication and repair machinery . This interaction inhibits MCM5 ubiquitination, thereby preventing its proteasomal degradation and extending its half-life . The stabilized MCM5 enhances the cell's capacity to repair cisplatin-induced DNA damage, allowing cancer cells to survive despite treatment .

Experimental validation has shown that silencing of any component in this pathway (VN1R5, lnc-POP1-1, or MCM5) resensitizes resistant HNSCC cells to cisplatin, confirming the interdependence of these factors in mediating drug resistance . This mechanistic understanding provides multiple potential intervention points for overcoming cisplatin resistance in HNSCC patients with elevated VN1R5 expression.

What are the optimal methods for detecting VN1R5 expression in different tissue samples?

For detecting VN1R5 expression in tissue samples, multiple complementary approaches are recommended to ensure accurate and comprehensive assessment:

  • Quantitative PCR (qPCR): For mRNA level detection, qPCR has been successfully employed using VN1R5-specific primers . This method is particularly useful for screening multiple samples and provides quantitative data on expression levels.

  • Western Blotting: For protein-level detection, western blotting using a VN1R5-specific antibody (such as Biorbyt cat# orb165310, 1:1000 dilution) provides information about protein expression and potential post-translational modifications .

  • Immunohistochemistry (IHC): For spatial localization within tissues, IHC can be employed to visualize VN1R5 distribution patterns, particularly valuable in heterogeneous samples like tumor tissues .

For maximal specificity, especially in tissues with potentially low expression levels, combining at least two independent detection methods is advised. When analyzing clinical samples, correlation with patient metadata (such as treatment response and survival data) significantly enhances the translational relevance of expression findings.

How can researchers effectively express and purify recombinant VN1R5 for functional studies?

Expressing and purifying functional VN1R5 presents challenges common to membrane proteins. Based on available research, the following methodology is recommended:

For functional studies:

  • Mammalian expression systems: HeLa/Olf cells have proven effective for functional expression of VN1R5 . N-terminal tagging (such as FLAG or HA) facilitates detection while preserving function. Transfection followed by selection of stable expressors ensures consistent protein levels.

  • Verification of membrane localization: Immunofluorescence microscopy should be employed to confirm proper plasma membrane localization, which is critical for functional studies .

For biochemical and structural studies:

  • E. coli expression systems: Full-length human VN1R5 with His-tags has been successfully expressed in E. coli . Optimization of expression conditions (temperature, induction time, and inducer concentration) is crucial for yield and solubility.

  • Solubilization and purification: Membrane fraction extraction followed by solubilization using mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS) helps maintain protein structure. Affinity chromatography using the His-tag allows initial purification, followed by size exclusion chromatography for higher purity.

For both approaches, functional validation through ligand binding or signaling assays should be performed to ensure the recombinant protein retains native activity.

What experimental approaches are most effective for studying VN1R5-mediated signaling pathways?

Investigating VN1R5-mediated signaling pathways requires multi-faceted approaches targeting different levels of the signaling cascade:

  • cAMP signaling detection: Since VN1R5 activates cAMP pathways, ELISA-based cAMP detection kits or real-time cAMP biosensors (such as EPAC-based FRET sensors) provide direct measurement of receptor activation .

  • PKA activity assays: To assess downstream effects, PKA activity can be measured using phosphorylation-specific antibodies targeting PKA substrates or using synthetic peptide substrates with detection of phosphorylation levels .

  • Transcription factor activation: Chromatin immunoprecipitation (ChIP) assays using antibodies against phosphorylated Sp1 (phospho-T453) help determine binding to target promoters like lnc-POP1-1 .

  • Target gene expression: Quantitative PCR or RNA-seq approaches measure changes in lnc-POP1-1 expression levels following VN1R5 activation or inhibition .

  • Pathway manipulation: Pharmacological activators (forskolin for adenylyl cyclase) or inhibitors (H89 for PKA), along with genetic approaches (siRNA, CRISPR-Cas9), allow validation of pathway components .

A comprehensive signaling study would integrate these approaches, starting with receptor activation at the membrane and tracking downstream effects to transcriptional changes, providing a complete picture of the VN1R5 signaling cascade.

How should researchers interpret contradictory data regarding VN1R5 function across different experimental systems?

When encountering contradictory results regarding VN1R5 function across different experimental systems, researchers should consider several key factors for proper interpretation:

  • Expression system differences: The cellular context significantly impacts VN1R5 function. For instance, findings in HeLa/Olf cells may differ from those in native tissues due to differences in available G proteins and downstream effectors . Systematically compare expression levels, subcellular localization, and the presence of auxiliary proteins across systems.

  • Species-specific variations: Despite structural similarities, human VN1R5 functions differently from mouse vomeronasal receptors . When comparing across species, consider evolutionary divergence and potential functional repurposing.

  • Methodological variations: Differences in detection sensitivity, activation measurement methods, and experimental timeframes can lead to apparently contradictory results. Standardizing methodologies or directly comparing methods within a single experimental setup can help resolve such contradictions.

  • Context-dependent signaling: VN1R5 may exhibit biased signaling depending on the ligand and cellular environment . Comprehensive profiling of multiple downstream pathways following activation by different ligands can reveal such functional selectivity.

  • Integration approach: When faced with contradictory data, a Bayesian integration approach that weighs evidence based on methodological rigor, reproducibility, and biological relevance provides the most balanced interpretation.

The apparent contradiction between traditional pheromone receptor classification and odorant-responsive, cAMP-coupled signaling of human VN1R5 exemplifies how evolutionary context and appropriate experimental design are crucial for accurate interpretation.

What statistical approaches are most appropriate for analyzing VN1R5 expression data in clinical samples?

For analyzing VN1R5 expression data in clinical samples, the following statistical approaches are recommended based on research methodologies:

  • Differential expression analysis: For comparing VN1R5 expression between patient groups (e.g., cisplatin-resistant vs. sensitive), Student's t-test (for normally distributed data) or Mann-Whitney U test (for non-parametric data) with appropriate multiple testing correction should be employed .

  • Survival analysis: Kaplan-Meier analysis with log-rank test is appropriate for correlating VN1R5 expression levels with patient survival outcomes . This approach requires categorizing patients into high and low expression groups, typically using median expression as the threshold.

  • Multivariate analysis: Cox proportional hazards regression model should be used to determine whether VN1R5 expression is an independent prognostic factor when accounting for clinical variables such as age, sex, tumor stage, and treatment regimen .

  • Correlation analyses: Spearman's or Pearson's correlation coefficients (depending on data distribution) are suitable for analyzing relationships between VN1R5 and other molecular markers like lnc-POP1-1 or MCM5 .

  • Power analysis: For clinical studies, a priori power analysis should determine the sample size needed to detect clinically meaningful differences in VN1R5 expression or its prognostic impact, typically aiming for 80% power with α=0.05.

When analyzing expression data from heterogeneous tissues like tumors, considering spatial expression patterns and potential confounding by tumor purity and composition enhances the robustness of statistical interpretations.

How can researchers validate the specificity of VN1R5 ligand interactions in functional assays?

Validating the specificity of VN1R5 ligand interactions requires a systematic approach combining multiple complementary methodologies:

  • Dose-response relationships: Establish complete dose-response curves for putative ligands (particularly C9-C10 aliphatic alcohols and aldehydes), determining EC50 values with 95% confidence intervals . True ligands should activate the receptor in a concentration-dependent manner with physiologically relevant potency.

  • Structure-activity relationship (SAR) analysis: Test a panel of structurally related compounds with systematic modifications to identify key molecular features required for receptor activation . The pattern of activation across the panel should be consistent with specific receptor-ligand interactions.

  • Competitive binding assays: For direct validation, perform competition assays with labeled known ligands to determine binding affinity (Ki values) of test compounds. Specific interactions should demonstrate competitive displacement with expected rank-order potency.

  • Receptor specificity controls: Compare responses between cells expressing VN1R5 and those expressing related receptors or empty vector controls . Specific ligands should show significantly higher activity in VN1R5-expressing cells.

  • Genetic validation: Use site-directed mutagenesis to modify predicted ligand-binding residues in VN1R5, confirming that specific mutations alter ligand potency or efficacy in predictable ways based on molecular modeling.

  • Signal transduction specificity: Monitor multiple downstream pathways (cAMP, Ca2+, ERK) to develop signaling fingerprints for each ligand, helping distinguish between full and biased agonists and eliminating false positives from non-specific cellular effects.

A comprehensive validation approach incorporating these methodologies will provide convincing evidence for specific VN1R5-ligand interactions while ruling out experimental artifacts.

What is the clinical significance of VN1R5 expression in cancer and potential therapeutic implications?

VN1R5 has emerged as a clinically significant biomarker and potential therapeutic target in cancer, particularly in head and neck squamous cell carcinoma (HNSCC) . Its clinical relevance is evidenced by several key findings:

  • Prognostic value: High VN1R5 expression is associated with significantly poorer 5-year survival rates in HNSCC patients, making it a valuable prognostic biomarker . Patients with elevated VN1R5 expression show worse clinical outcomes independent of other clinicopathological factors.

  • Prediction of treatment response: VN1R5 overexpression strongly correlates with resistance to cisplatin-based chemotherapy regimens, including the TPF (docetaxel+cisplatin+5-fluorouracil) protocol commonly used in HNSCC . This makes VN1R5 a potential predictive biomarker for therapy selection.

  • Therapeutic targeting potential: Experimental knockdown of VN1R5 resensitizes resistant cancer cells to cisplatin both in vitro and in vivo, suggesting that VN1R5 inhibition could be a viable strategy for overcoming chemoresistance .

The VN1R5/lnc-POP1-1/MCM5 pathway offers multiple intervention points for therapeutic development, including:

  • Direct inhibition of VN1R5 receptor function

  • Disruption of the cAMP/PKA/Sp1 signaling axis

  • Targeting lnc-POP1-1 expression or function

  • Modulation of MCM5 stability or activity

Development of VN1R5 antagonists or downstream pathway inhibitors could potentially expand treatment options for cisplatin-resistant HNSCC and possibly other cancers where this pathway is active.

How can VN1R5 expression data be integrated into predictive models for chemotherapy response?

Integrating VN1R5 expression data into predictive models for chemotherapy response requires a multifaceted approach combining molecular, clinical, and computational methods:

  • Biomarker panel development: Rather than relying on VN1R5 alone, develop a comprehensive panel including downstream effectors like lnc-POP1-1 and MCM5 . This multi-marker approach provides redundancy and captures the entire signaling pathway's activity.

  • Quantitative threshold determination: Establish standardized quantitative thresholds for VN1R5 expression levels that optimally discriminate between responders and non-responders through ROC curve analysis and calculation of sensitivity, specificity, and predictive values .

  • Multivariate predictive modeling: Develop machine learning models (such as random forests or support vector machines) that incorporate:

    • VN1R5 expression levels

    • Expression of pathway components (lnc-POP1-1, MCM5)

    • Standard clinical parameters (tumor stage, grade, location)

    • Additional molecular markers of chemoresistance

  • Model validation: Validate predictive models using independent patient cohorts through retrospective analysis of archival samples with known treatment outcomes, followed by prospective validation in clinical trials .

  • Dynamic monitoring: Incorporate longitudinal assessment of VN1R5 expression before, during, and after treatment to capture the dynamic nature of chemoresistance development.

  • Implementation strategy: Develop standardized testing protocols compatible with clinical laboratory settings, including quality control measures and reference standards to ensure reproducibility across institutions.

The integration of VN1R5 expression data into clinical decision-making tools could significantly improve patient stratification for cisplatin-based therapies, potentially sparing non-responders from ineffective treatments while identifying those most likely to benefit.

What methodological considerations are important when designing clinical studies to evaluate VN1R5 as a biomarker?

When designing clinical studies to evaluate VN1R5 as a biomarker, several critical methodological considerations must be addressed:

  • Sample collection and processing standardization:

    • Use consistent tissue preservation methods (FFPE vs. fresh-frozen)

    • Standardize RNA/protein extraction protocols to minimize technical variability

    • Implement quality control measures for sample adequacy (tumor content, RNA integrity)

  • Expression detection methods:

    • Select clinically implementable detection platforms (qPCR, IHC)

    • Validate antibody specificity thoroughly for IHC applications

    • Establish reference standards for quantification

    • Use multiple detection methods for cross-validation

  • Study design considerations:

    • Prospective collection with predefined endpoints is preferable to retrospective analysis

    • Include appropriate sample size based on power calculations

    • Stratify patients based on relevant clinical factors (tumor site, stage, treatment regimen)

    • Include treatment-naïve samples as well as matched pre/post-treatment pairs when possible

  • Statistical analysis plan:

    • Predefine primary and secondary endpoints

    • Include both continuous and categorical analysis of VN1R5 expression

    • Account for multiple testing when assessing multiple biomarkers

    • Include multivariate analysis adjusting for known prognostic factors

  • Translational relevance:

    • Correlate biomarker findings with functional studies to establish biological significance

    • Assess potential therapeutic implications based on biomarker status

    • Evaluate cost-effectiveness of biomarker implementation in clinical practice

A well-designed clinical validation study following these considerations would significantly strengthen the evidence base for VN1R5 as a clinically useful biomarker in precision oncology applications.

What are the most promising future research directions for VN1R5 studies?

The current understanding of VN1R5 points to several promising research directions that merit further investigation:

  • Structural biology approaches: Determining the crystal structure or cryo-EM structure of VN1R5 would provide invaluable insights into ligand binding mechanisms and facilitate structure-based drug design for potential therapeutic applications. This approach could reveal unique structural features that differentiate human VN1R5 from rodent vomeronasal receptors .

  • Physiological function elucidation: While VN1R5's role in cancer has been partly characterized, its normal physiological function in humans remains elusive. Investigations using tissue-specific expression analysis, knockout models, and comprehensive ligand screening would help clarify its endogenous roles beyond potential olfactory functions .

  • Expanded cancer relevance: Building on findings in HNSCC, exploring VN1R5's role in other cancer types, particularly those frequently treated with platinum-based chemotherapy (ovarian, lung, bladder), could reveal broader clinical applications .

  • Therapeutic development: Developing specific antagonists or negative allosteric modulators targeting VN1R5 represents a promising approach for overcoming chemoresistance. High-throughput screening campaigns followed by medicinal chemistry optimization could yield clinical candidates .

  • Signaling network mapping: Comprehensive characterization of VN1R5's interactome and signaling pathways in different cellular contexts would provide deeper understanding of its context-dependent functions and identify additional intervention points .

These research directions, pursued in parallel, would substantially advance our understanding of this intriguing receptor and potentially yield novel therapeutic strategies for chemoresistant cancers.

How does current research on VN1R5 fit into the broader context of GPCR biology and chemoresistance mechanisms?

VN1R5 research bridges multiple scientific domains and offers unique insights that connect GPCR biology with cancer chemoresistance mechanisms:

  • Evolutionary repurposing of GPCRs: VN1R5 exemplifies how vestigial sensory receptors can be repurposed for novel functions during evolution. While retaining structural characteristics of vomeronasal receptors, human VN1R5 demonstrates signaling properties more aligned with odorant receptors, suggesting functional adaptation despite structural conservation . This provides a valuable model for studying GPCR functional evolution.

  • Unconventional GPCR signaling in cancer: The involvement of VN1R5 in chemoresistance highlights the expanding recognition of GPCR significance in cancer biology beyond traditional growth factor receptors . This aligns with emerging evidence that various GPCRs contribute to cancer progression, metastasis, and treatment resistance through diverse signaling mechanisms.

  • Novel non-coding RNA regulation: The VN1R5-mediated regulation of lnc-POP1-1 reveals a previously unappreciated mechanism by which GPCRs can influence gene expression through long non-coding RNAs . This expands our understanding of GPCR signaling beyond canonical second messenger systems.

  • Integrated chemoresistance pathways: The VN1R5/lnc-POP1-1/MCM5 axis represents a novel mechanism of chemoresistance that integrates membrane receptor signaling, transcriptional regulation, and DNA repair machinery . This pathway adds to our understanding of the diverse mechanisms underlying platinum resistance.

  • Druggable targets in resistance pathways: The involvement of a GPCR in chemoresistance is particularly significant given that GPCRs are highly druggable targets. Approximately 35% of FDA-approved drugs target GPCRs, suggesting that pharmacological intervention at the level of VN1R5 could be feasible .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.