Recombinant Human XK-related protein 7 (XKR7)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Recombinant XKR7 is typically expressed in mammalian cells (e.g., HEK293) with a His-tag for purification. Production details include:

  • Purity: >80% as determined by SDS-PAGE .

  • Form: Liquid or lyophilized powder, stored at -20°C to -80°C .

  • Sequence: Full-length or partial fragments (e.g., aa 442–530 for control experiments) .

Table 3: Functional Comparison of Xkr Family Members

ProteinCaspase CleavagePtdSer Exposure ActivityTissue Expression
XKR7PresentNoUbiquitous
Xkr4PresentYes (requires caspase 6)Brain
Xkr8PresentYes (ubiquitous)Ubiquitous
Xkr9PresentYes (requires caspase 6)Intestine
Data compiled from .

Applications in Research and Experimental Use

Recombinant XKR7 is utilized in:

  • Antibody Validation: Used as a control fragment (aa 442–530) to block PA5-59326 antibody binding in IHC/WB assays .

  • Engulfment Studies: Co-expressed with other Xkr proteins to study apoptotic cell clearance mechanisms .

  • Structural Analysis: His-tagged versions enable purification for biophysical studies (e.g., membrane topology) .

Key Tools:

  • Antibodies: Polyclonal anti-XKR7 (Atlas Antibodies HPA040854) for IHC/ICC/WB .

  • Control Fragments: Recombinant aa 442–530 (Invitrogen RP-98368) for blocking experiments .

Challenges and Future Directions

  • Functional Ambiguity: XKR7’s exact role in apoptosis remains unclear due to limited rescuing activity in Xkr8−/− cells .

  • Interaction Studies: Further research is needed to explore its potential association with the Kell blood group system .

  • Therapeutic Potential: Investigating XKR7’s role in diseases linked to chromosome 20 (e.g., Alagille syndrome, ALS) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
XKR7; C20orf159; XRG7; XK-related protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-579
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
XKR7
Target Protein Sequence
MAAKSDGAAASASPDPEGAAGGARGSAGGRGEAAAAAGPPGVVGAGGPGPRYELRDCCWV LCALLVFFSDGATDLWLAASYYLQNQHTYFSLTLLFVLLPSLVVQLLSFRWFVYDYSEPA GSPGPAVSTKDSVAGGAAISTKDSAGAFRTKEGSPEPGPQPAPSSASAYRRRCCRLCIWL LQTLVHLLQLGQVWRYLRALYLGLQSRWRGERLRRHFYWQMLFESADVSMLRLLETFLRS APQLVLQLSLLVHRGGAPDLLPALSTSASLVSLAWTLASYQKVLRDSRDDKRPLSYKGAV AQVLWHLFSIAARGLAFALFASVYKLYFGIFIVAHWCVMTFWVIQGETDFCMSKWEEIIY NMVVGIIYIFCWFNVKEGRSRRRMTLYHCIVLLENAALTGFWYSSRNFSTDFYSLIMVCV VASSFALGIFFMCVYYCLLHPNGPMLGPQAPGCIFRKASEPCGPPADAITSPPRSLPRTT GAERDGASAGERAGTPTPPVFQVRPGLPPTPVARTLRTEGPVIRIDLPRKKYPAWDAHFI DRRLRKTILALEYSSPATPRLQYRSVGTSQELLEYETTV
Uniprot No.

Target Background

Database Links

HGNC: 23062

KEGG: hsa:343702

STRING: 9606.ENSP00000217299

UniGene: Hs.666444

Protein Families
XK family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is XKR7 and what is its predicted function in human biology?

XKR7 (XK Related 7) is a protein-coding gene belonging to the XK family. It is predicted to be involved in apoptotic processes related to development, engulfment of apoptotic cells, and phosphatidylserine exposure on apoptotic cell surfaces . Unlike its family members XKR4, XKR8, and XKR9 which facilitate phosphatidylserine exposure during apoptosis, XKR7 does not support scramblase activity despite having a putative caspase cleavage sequence . Current research suggests XKR7 may instead function as an ion channel potentially involved in cell shrinkage during apoptosis .

How does XKR7 compare structurally and functionally to other members of the XKR family?

Position (XKR8 numbering)Residue in functional scramblasesResidue in XKR7Functional impact
35ValineAlanineLimited impact on function
141Glutamic acidArginineCritical for scramblase activity
163GlutamineThreonineLimited impact on function
184SerineValineCritical for scramblase activity
216IsoleucineThreonineLimited impact on function
305ValineSerineLimited impact on function
309ThreoninePhenylalanineLimited impact on function

Mutagenesis studies have shown that particularly the E141R and S184V substitutions in XKR8 (mimicking XKR7) abolish scramblase activity, explaining why XKR7 lacks this function despite structural similarities to other family members .

What is the tissue distribution pattern of XKR7 expression?

While the tissue distribution pattern of XKR7 is not explicitly detailed in the search results, comparing to other XKR family members provides insights. Unlike XKR8, which is ubiquitously expressed, XKR4 and XKR9 show tissue-specific expression (brain and intestine, respectively) . By analogy, XKR7 likely exhibits tissue-specific expression patterns as well. For definitive determination of XKR7 expression patterns, researchers should perform RT-PCR analysis using tissue-specific cDNA libraries similar to the approach used for other XKR family members . Alternatively, RNA-seq databases can provide preliminary expression data across various tissues.

What are effective methods for cloning and expressing recombinant human XKR7?

Based on successful approaches with other XKR family members, the following methodology is recommended for XKR7:

  • cDNA preparation: Isolate total RNA from tissues with known XKR7 expression, perform RT-PCR using XKR7-specific primers designed from GenBank reference sequences .

  • Expression vector construction: Insert the XKR7 coding sequence between appropriate restriction sites (e.g., BamHI and EcoRI) in mammalian expression vectors such as pMXs-puro c-GFP or pMXs-puro c-FLAG for C-terminal tagging .

  • Transfection protocol: For transient expression in mammalian cells, mix purified plasmid DNA with PEI MAX in a 1:2.5 ratio, dilute in non-supplemented DMEM to 0.01 mg DNA per ml, and add valproic acid (3.5 mM) immediately after transfection .

  • Stable cell line generation: For stable expression, consider using retroviral transduction systems with appropriate selection markers, following verification of sequence integrity by sequencing .

For optimal expression, the use of codon-optimized sequences may enhance protein yield, particularly for structural studies requiring large amounts of purified protein.

How can researchers purify recombinant XKR7 for structural and functional studies?

The following purification protocol can be adapted from successful approaches used with related XKR proteins:

  • Cell harvesting: Collect cells 48 hours post-transfection, wash with PBS, and freeze cell pellets in liquid N₂ for storage at -80°C until purification .

  • Membrane protein extraction: Resuspend thawed pellets in lysis buffer (25 mM HEPES pH 7.5, 200 mM NaCl) containing appropriate detergents (1% LMNG or 2% GDN) and protease inhibitors (0.1 μM PMSF, 10 μM leupeptin, 1 mM benzamidine, 1 μM pepstatin) .

  • Solubilization: Gently mix for 2 hours at 4°C to solubilize membrane proteins, then remove insoluble material by ultracentrifugation at 85,000 g for 30 minutes .

  • Affinity purification: For Strep-tagged constructs, incubate the supernatant with Streptactin superflow resin (1 ml 50% slurry per liter of culture) for 2.5 hours. Wash with 50 column volumes of SEC buffer (25 mM HEPES pH 7.5, 200 mM NaCl, 0.01% LMNG or 0.03% GDN) and elute with 10 mM desthiobiotin .

  • Tag removal: If necessary, cleave affinity tags using appropriate proteases (e.g., HRV 3C protease for PreScission sites) .

  • Size exclusion chromatography: Concentrate the protein using appropriate molecular weight cut-off concentrators and perform SEC using Superdex 200 columns to obtain homogeneous protein preparations .

This protocol should be optimized specifically for XKR7, as detergent preferences and stability may vary between XKR family members.

What are appropriate cell models for studying XKR7 function in apoptotic processes?

Several cell systems have proven useful for studying XKR family members and would be appropriate for XKR7 research:

  • PLB-985 cells: Human myeloid leukemia cells successfully used for expression and functional characterization of XKR mutants .

  • WR-Fas cells: Mouse WR19L cells transformed with mouse Fas, valuable for studying caspase-mediated cleavage of XKR proteins .

  • IFET-Fas cells: Xkr8−/− immortalized fetal thymocytes expressing mouse Fas provide an ideal background for studying XKR function in the absence of endogenous XKR8 activity .

  • HEK293T cells: Widely used for protein expression and easily transfectable, suitable for initial characterization studies .

When selecting cell models, consider:

  • Endogenous expression levels of XKR family members

  • Efficiency of apoptosis induction methods in the cell type

  • Cell type-specific factors that might influence XKR7 function

  • The need for tissue-relevant cellular environments if studying tissue-specific functions

For advanced studies, CRISPR-Cas9 genome editing can be employed to generate XKR7 knockout or knock-in cell lines for more precise functional characterization.

How can researchers assess the potential ion channel function of XKR7?

To investigate XKR7's hypothesized role as an ion channel during apoptosis, researchers should employ a multifaceted approach:

  • Electrophysiological methods: Whole-cell patch-clamp recording to measure ion currents in cells expressing XKR7 before and after apoptosis induction or direct caspase activation. Compare currents with those in control cells or cells expressing known ion channels involved in apoptotic volume decrease.

  • Ion flux assays: Use fluorescent ion indicators (e.g., SBFI for Na⁺, PBFI for K⁺, Fluo-4 for Ca²⁺) to monitor changes in intracellular ion concentrations upon XKR7 activation during apoptosis.

  • Cell volume measurements: Employ Coulter counter technology, digital holographic microscopy, or fluorescent volume indicators to quantify XKR7's contribution to apoptotic volume decrease.

  • Reconstitution studies: Purify XKR7 protein and reconstitute it into liposomes loaded with fluorescent indicators to assess ion channel activity in a defined system.

  • Mutational analysis: Create XKR7 mutants with alterations in predicted pore-forming regions and assess their impact on any observed ion channel activity.

  • Pharmacological characterization: Test the effects of known ion channel blockers on XKR7-mediated activities to establish a pharmacological profile.

This integrated approach can help determine whether XKR7 functions as an ion channel and, if so, its ion selectivity and regulatory mechanisms.

What is the significance of the caspase cleavage site in XKR7, and how does it compare to other XKR family members?

The caspase cleavage site in XKR7 represents a critical regulatory element that may control its activation during apoptosis. While XKR7 contains a putative caspase recognition site, it differs from those in functional scramblases:

XKR Family MemberCaspase Recognition SequencePrimary Caspases
XKR4AERDG (positions 561-564)Caspases 3, 6, 7
XKR8 (human)DQVDGCaspases 3, 7
XKR8 (mouse)DLVDGCaspases 3, 7
XKR9DETDG (positions 354-357)Caspases 3, 6, 7
XKR7Not specified in resultsPredicted similar to XKR4

To characterize the XKR7 caspase cleavage site, researchers should:

  • Identify the exact sequence through comparative analysis and confirm it experimentally through in vitro caspase cleavage assays .

  • Create site-directed mutants (e.g., changing the critical aspartate residue to alanine) to determine if cleavage is necessary for any observed XKR7 function .

  • Assess which specific caspases can cleave XKR7 by treating membrane fractions with recombinant caspases 1-10 and analyzing by Western blot .

  • Investigate whether XKR7 cleavage occurs during different types of cell death and in response to various apoptotic stimuli.

Understanding these regulatory mechanisms is crucial for determining how XKR7 might be activated in physiological and pathological contexts.

How can researchers differentiate between XKR7's functions and those of other XKR family members?

Distinguishing XKR7's specific functions from other family members requires targeted experimental approaches:

  • Knockout models: Generate and characterize XKR7 knockout cells/animals and compare phenotypes with knockouts of other XKR family members, particularly under apoptotic conditions.

  • Tissue-specific studies: Focus investigations on tissues where XKR7 is highly expressed while other family members show limited expression.

  • Rescue experiments: Assess whether XKR7 can rescue phenotypes in cells deficient in other XKR proteins (e.g., Xkr8−/− cells), and vice versa .

  • Apoptotic assay panel:

    • Phosphatidylserine exposure (Annexin V binding)

    • Cell volume changes (apoptotic volume decrease)

    • Ion flux measurements

    • Phagocytosis by macrophages

  • Domain swapping: Create chimeric proteins by exchanging domains between XKR7 and other family members to map functional regions responsible for different activities.

  • Caspase specificity: Exploit the differential caspase sensitivity of XKR family members; XKR4 and XKR9 are cleaved by caspase 6 in addition to caspases 3 and 7 .

This systematic approach can help delineate the unique contributions of XKR7 to cellular processes relative to other XKR family members.

What is the evidence linking XKR7 to Gnathodiaphyseal Dysplasia?

To investigate this link, researchers should:

  • Analyze GDD patient samples for mutations in the XKR7 gene

  • Characterize the functional consequences of any identified mutations using in vitro assays

  • Develop animal models (e.g., mice with equivalent mutations) to study the pathophysiological mechanisms

  • Investigate the role of XKR7 in bone development and homeostasis

  • Examine if XKR7's potential ion channel function might explain bone abnormalities in GDD

The association with GDD suggests that XKR7 may have important functions beyond apoptosis, potentially in calcium homeostasis or other processes critical for bone development and maintenance.

How might XKR7 research contribute to understanding neurological disorders?

Given that XKR4, a close paralog of XKR7, is highly expressed in the brain and may be involved in the pruning process of axons, dendrites, and synapses , XKR7 might play complementary roles in neural development and function. To explore this:

  • Neural expression mapping: Characterize XKR7 expression in different brain regions and during developmental stages.

  • Synaptic pruning studies: Investigate whether XKR7 contributes to microglial recognition of synapses tagged for elimination, similar to the proposed role for XKR4 .

  • Neurodevelopmental models: Study XKR7 knockout or overexpression in neuronal cultures and animal models, assessing impacts on neuronal morphology, connectivity, and function.

  • Neurological disease associations: Screen for XKR7 variants in patients with neurodevelopmental or neurodegenerative disorders, particularly those involving abnormal apoptosis or synaptic pruning.

  • Caspase-dependent neural remodeling: Investigate whether localized caspase activation in neurons affects XKR7 function during neural circuit refinement.

This research direction could reveal important roles for XKR7 in brain development and neurological disease pathogenesis, expanding our understanding beyond its potential functions in apoptosis.

What cutting-edge technologies could advance our understanding of XKR7 function?

Several emerging technologies offer promising approaches for XKR7 research:

  • Cryo-EM structural analysis: Building on successful approaches with XKR9 , cryo-EM could reveal XKR7's structural features, particularly before and after caspase cleavage.

  • Nanobody development: Synthetic nanobodies, as used with XKR9 , could serve as valuable tools for structural studies and functional modulation of XKR7.

  • Single-cell analysis: Techniques like single-cell RNA-seq and mass cytometry could reveal heterogeneity in XKR7 expression and function across cell populations and states.

  • In situ structural biology: Approaches like proximity labeling and cross-linking mass spectrometry could map XKR7's interactions within native cellular environments.

  • Optogenetic and chemogenetic tools: Developing methods for acute activation or inhibition of XKR7 would allow temporal control over its function for precise mechanistic studies.

  • Advanced microscopy: Super-resolution and live-cell imaging techniques could visualize XKR7 dynamics during apoptosis and other cellular processes.

  • Organ-on-a-chip models: These systems could provide physiologically relevant environments for studying XKR7 function in tissue-specific contexts.

Integrating these technologies with traditional biochemical and cell biological approaches will significantly enhance our understanding of XKR7's structure, function, and physiological roles.

What are the most important unanswered questions about XKR7 that researchers should address?

Key questions that remain to be addressed include:

  • Precise molecular function: Does XKR7 function as an ion channel as hypothesized, and if so, what is its ion selectivity and gating mechanism?

  • Physiological role: What is XKR7's role in normal development and tissue homeostasis beyond potential apoptotic functions?

  • Tissue-specific expression: What is the complete expression profile of XKR7 across tissues and developmental stages?

  • Regulatory mechanisms: Beyond caspase cleavage, what other post-translational modifications and protein-protein interactions regulate XKR7?

  • Evolutionary significance: Why has XKR7 diverged functionally from other XKR family members while maintaining structural similarity?

  • Disease relevance: What is the mechanistic basis for XKR7's association with Gnathodiaphyseal Dysplasia, and are there other diseases linked to XKR7 dysfunction?

  • Therapeutic potential: Could modulation of XKR7 function provide therapeutic benefits in diseases involving dysregulated apoptosis or ion homeostasis?

Addressing these questions will require interdisciplinary approaches and collaboration between structural biologists, cell biologists, physiologists, and clinicians to fully elucidate XKR7's functions and significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.