Recombinant Human Xyloside xylosyltransferase 1 (XXYLT1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Xyloside Xylosyltransferase 1 (XXYLT1)

Xyloside xylosyltransferase 1 (XXYLT1) is an enzyme involved in glycosylation, the process of adding sugar molecules to other molecules . Specifically, XXYLT1 is an alpha-1,3-xylosyltransferase that elongates the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of target proteins . The gene that encodes XXYLT1 is located on chromosome 11q25 . XXYLT1 requires a divalent cation for its activity .

Structure and Function

XXYLT1 exhibits a glycosyltransferase GT-A fold, characterized by a DXD motif (aspartate-X-aspartate, amino acids 225-227), which coordinates a manganese ion in the active site . The enzyme functions as a dimer .

Role in Cancer

XXYLT1 has been identified as potentially significant in the pathogenesis of lung adenocarcinoma . Studies have shown that XXYLT1 mRNA expression is lower in lung cancer tissues compared to normal lung tissues, especially in male patients .

  • DNA Methylation: Hypermethylation of XXYLT1 is associated with lower mRNA expression levels in lung cancer patients . Methylation of XXYLT1 may be a useful biomarker for an increased risk of lung cancer, suggesting XXYLT1 could be a potential novel target for the development of lung cancer therapeutics .

  • Mutation Distribution: The COSMIC database provides information regarding mutations of XXYLT1 in various cancers .

    Mutation (Amino Acid)Mutation ID (COSF)CountMutation Type

Expression

XXYLT1 is expressed in various tissues, with protein expression data available through The Human Protein Atlas .

  • XXYLT1 mRNA expression was lower in the cancer tissues than in the para-carcinoma tissues in male patients in the first step, and significantly lower than that in lung normal tissues in the second step . The XXYLT1 expression was found to be negatively regulated by the Notch pathway, and the attenuated activity of XXYLT1 resulted in the elevation of Notch signaling .

Research Findings

Research indicates that XXYLT1 could be an antioncogene . A study explored the role of XXYLT1 methylation in lung adenocarcinoma and found that XXYLT1 mRNA expression was significantly lower in cancer tissues .

Table 1. XXYLT1 mRNA Expression in Lung Tissues

All patientsFemale patientsMale patients
CA0.95 ± 0.211.03 ± 0.180.88 ± 0.24
CP1.00 ± 0.141.00 ± 0.161.00 ± 0.10
P value.179.662.017

CA = cancer tissues

CP = para-carcinoma tissues

Table 2. XXYLT1 mRNA Expression between Cancer and Normal Lung Tissues

All patientsFemale patientsMale patients
Cancer tissues0.93 ± 0.250.97 ± 0.250.90 ± 0.25
Normal lung tissues1.00 ± 0.181.00 ± 0.201.00 ± 0.15
P value< .001.064< .001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
XXYLT1; C3orf21; PSEC0251; Xyloside xylosyltransferase 1; UDP-xylose:alpha-xyloside alpha-1,3-xylosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
XXYLT1
Target Protein Sequence
MGLLRGGLPCARAMARLGAVRSHYCALLLAAALAVCAFYYLGSGRETFSSATKRLKEARA GAPAAPSPPALELARGSVAPAPGAKAKSLEGGGAGPVDYHLLMMFTKAEHNAALQAKARV ALRSLLRLAKFEAHEVLNLHFVSEEASREVAKGLLRELLPPAAGFKCKVIFHDVAVLTDK LFPIVEAMQKHFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFE EFDSFLPGAIIGIAREMQPVYRHTFWQFRHENPQTRVGGPPPEGLPGFNSGVMLLNLEAM RQSPLYSRLLEPAQVQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDCTWNRQLCTWW RDHGYSDVFEAYFRCEGHVKIYHGNCNTPIPED
Uniprot No.

Target Background

Function

Alpha-1,3-xylosyltransferase extends the O-linked xylose-glucose disaccharide attached to EGF-like repeats in the extracellular domain of target proteins. This enzyme catalyzes the addition of a second xylose residue. Known targets include Notch proteins and coagulation factors such as Factor IX (F9).

Gene References Into Functions
  1. Our research indicates that individuals with the C30rf21 rs2131877 T/C+C/C genotype may exhibit increased nicotine addiction. Furthermore, C30rf21 may serve as a susceptibility marker for lung adenocarcinoma with a higher degree of malignancy. PMID: 28422717
Database Links

HGNC: 26639

OMIM: 614552

KEGG: hsa:152002

STRING: 9606.ENSP00000309640

UniGene: Hs.478741

Protein Families
Glycosyltransferase 8 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is the structural organization and cellular localization of XXYLT1?

XXYLT1 is a type II membrane protein located in the endoplasmic reticulum with its catalytic domain extending into the luminal region. Structurally, XXYLT1 has a GT-A fold with the glycosyltransferase signature DXD motif (residues 225-227) that coordinates a Mn²⁺ ion in the active site pocket .

The protein exhibits an unexpected dimerization pattern via kinked tandem helixes 7-9, which likely provides additional dimerization contact beyond the AXXXA dimerization motif in the transmembrane helix . When properly oriented in the ER membrane, the enzyme's active pocket faces sideways, optimally positioned for lateral contact with luminally oriented EGF repeats of the Notch extracellular domain .

Methodological approach for localization studies:

  • Use both N-terminally and C-terminally tagged constructs to avoid influencing subcellular localization

  • Compare with typical Golgi-localized glycosyltransferases like B4GALT1 as controls

  • Employ double-tagged constructs to confirm consistent localization patterns

What is the primary enzymatic function of XXYLT1 and its role in glycosylation pathways?

XXYLT1 functions as an α1,3-xylosyltransferase that specifically transfers the second xylose to O-glucosylated EGF repeats of Notch . It acts as a negative regulator of the Notch signaling pathway, where reduced XXYLT1 activity leads to enhanced Notch signaling .

The enzyme's catalytic mechanism involves:

  • Transfer of a xylose moiety from UDP-xylose to a Xyl-Glc-O substrate

  • Formation of an α1,3-linkage between the two xylosyl units

  • Retention of stereochemistry after catalytic addition

This function places XXYLT1 as a key player in O-glycan processing, specifically in the modification of Notch receptor proteins, which has significant implications for cell fate decisions and development .

How does XXYLT1 relate to the Notch signaling pathway?

XXYLT1 serves as a negative regulator of Notch signaling through its xylosyltransferase activity . The Notch signaling pathway is essential for development and adult tissue homeostasis, with defective patterns causing various cancers and developmental disorders .

The regulatory mechanism involves:

  • XXYLT1 transfers a second xylose to Notch's O-glucosylated EGF repeats

  • This additional xylosylation modulates Notch activation

  • Decreased XXYLT1 expression or activity results in elevated Notch signaling

Multiple studies have shown that high expression levels of Notch1 and Notch3 genes are significantly associated with poor prognosis in lung adenocarcinoma, suggesting that XXYLT1's negative regulation of this pathway may contribute to its potential tumor-suppressive properties .

What methodologies are most effective for analyzing XXYLT1 methylation in cancer tissues?

Based on published studies, an effective methodology for XXYLT1 methylation analysis includes a two-step approach with both exploratory and validation phases:

Step 1: Exploratory analysis

  • Collect matched cancer and para-carcinoma tissues (study used 15 patients with lung adenocarcinoma)

  • Extract DNA and RNA from both tissue types

  • Analyze methylation status using MassARRAY Spectrometry

  • Process data with EpiTyper v1.0.5 software

Step 2: Validation analysis

  • Enroll a larger sample (150 patients used in referenced study)

  • Collect both cancer and normal lung tissue from each patient

  • Determine XXYLT1 mRNA expression levels

  • Analyze DNA methylation status using the same methods as in Step 1

Key metrics to analyze:

  • Methylation rates of specific CpG units (particularly CpG_23, CpG_25, and CpG_60.61.62.63.64.65)

  • XXYLT1 mRNA expression levels

  • Sex-disaggregated data analysis (given significant differences observed between male and female patients)

Patient GroupXXYLT1 mRNA in Cancer TissueXXYLT1 mRNA in Normal TissueP value
All patients0.93 ± 0.251.00 ± 0.18< .001
Female patients0.97 ± 0.251.00 ± 0.20.064
Male patients0.90 ± 0.251.00 ± 0.15< .001

Table adapted from referenced study showing differential XXYLT1 expression between cancer and normal tissues

How can researchers effectively design experiments to investigate XXYLT1's role in cancer progression?

Effective experimental design for studying XXYLT1 in cancer should include multiple complementary approaches:

In vitro studies:

  • Use XXYLT1 knockout cell lines (e.g., HeLa) to study cellular processes affected by XXYLT1 deletion

  • Compare gene expression, proliferation, apoptosis, and migration between knockout and wild-type cells

  • Conduct rescue experiments by reintroducing XXYLT1 to validate phenotypic changes

In vivo studies:

  • Analyze XXYLT1 expression and methylation in patient-derived tissues

  • Consider gender as a biological variable given observed sex differences in methylation patterns

  • Use xenograft models with XXYLT1-modified cancer cell lines

Experimental controls:

  • Include para-carcinoma tissues and normal tissues as controls

  • Use paired samples from the same patients when possible

  • Analyze gender-specific effects separately

Key design considerations:

  • Include sufficient sample size (minimum 150 patients recommended based on previous studies)

  • Incorporate randomization, replication, and blocking to reduce variability

  • Use orthogonal methods to validate findings (e.g., both methylation and expression analysis)

  • Consider factorial experimental design to assess interactions between XXYLT1 status and other cancer-related factors

What are the methodological challenges in studying the catalytic mechanism of XXYLT1?

Studying XXYLT1's catalytic mechanism presents several methodological challenges:

Structural complexity challenges:

  • XXYLT1 forms dimers in crystal lattice via kinked tandem helixes, requiring careful consideration during structural studies

  • The enzyme induces conformational changes in its substrate, complicating binding studies

  • Capturing transient reaction intermediates requires specialized techniques

Recommended approaches:

  • Use crystallographic techniques to capture snapshots along the reaction pathway

  • Employ natural and competent Michaelis reaction complexes for studying the retaining mechanism

  • Utilize structure-based mutagenesis (particularly targeting H262, W265, and G325) to validate catalytic mechanisms

  • Combine with in vitro glycosylation assays to confirm functional impacts

Specific techniques for mechanistic studies:

  • Limited proteolysis to remove unstructured loops (e.g., S43-V92) that may interfere with crystallization

  • Size exclusion chromatography to purify binary complexes

  • NMR spectroscopy (13C, 1H, and two-dimensional HSQC) to confirm the precise nature of reaction products

  • HPLC analysis to validate product formation

What considerations should be made when designing experiments that analyze gender-specific differences in XXYLT1 methylation?

The observed gender-specific differences in XXYLT1 methylation require special experimental design considerations:

Key experimental design elements:

  • Sample stratification: Design your experiment with pre-planned sex-disaggregated analysis

  • Power calculation: Ensure sufficient sample size for detecting differences within each gender group

  • Matched controls: Use gender-matched controls and consider hormonal status

  • Covariate analysis: Include potential confounding variables like age, smoking status, and genetic background

Statistical approach:

  • Implement a two-step analytical process similar to Vaissière et al. and Lin et al.

  • Test for interaction effects between gender and XXYLT1 methylation

  • Consider escape from X-inactivation tumor suppressor genes as potential mechanisms

Methodological recommendations:

  • For male patients, focus particularly on CpG_23, CpG_25, and CpG_60.61.62.63.64.65 methylation sites

  • Analyze both methylation status and mRNA expression levels simultaneously

  • Consider the potential impact of sex hormones on epigenetic regulation

  • Implement cross-validation techniques to confirm gender-specific findings

What are the optimal protocols for expressing and purifying recombinant XXYLT1 for functional and structural studies?

Based on successful structural studies, the following protocol is recommended for XXYLT1 expression and purification:

Expression system:

  • Use mammalian expression systems (HEK293 cells) for proper post-translational modifications

  • Consider baculovirus expression systems (Sf9 insect cells) for higher yield when appropriate

Expression construct design:

  • Remove the N-terminal unstructured loop (approximately S43-V92) to improve protein stability

  • Include a cleavable signal sequence for secretion

  • Add affinity tags (His-tag recommended) for purification

Purification protocol:

  • Apply conditional medium to nickel-affinity chromatography column

  • Perform limited proteolysis to remove unstructured regions if needed

  • Utilize size exclusion chromatography for further purification

  • Concentrate protein to ≥5 mg/ml for crystallization studies

Activity verification:

  • Confirm enzyme activity using UDP-xylose as donor and Xyl-Glc-R as acceptor substrate

  • Analyze reaction products by HPLC and/or NMR spectroscopy

  • Compare with synthetic reference trisaccharide (Xyl-Xyl-Glc-R)

How can researchers design effective mutation studies to investigate XXYLT1's function?

Based on structural and functional studies, an effective mutation study for XXYLT1 should:

Target key functional residues:

  • Active site residues: Focus on the DXD motif (residues 225-227) that coordinates Mn²⁺

  • Substrate binding residues: Target H262, W265, and G325 which stabilize EGF conformation

  • Dimerization interface: Investigate residues in helixes 7-9 involved in dimer formation

  • Transmembrane domain: Study the AXXXA dimerization motif that may contribute to ER retention

Experimental approach:

  • Generate alanine substitutions of targeted residues

  • Express mutant proteins in appropriate cell systems

  • Compare enzyme activity, localization, and dimerization properties with wild-type

  • Conduct structural analysis of informative mutants

Functional assays to include:

  • In vitro glycosylation assays using UDP-xylose and Xyl-Glc-modified EGF repeats

  • Subcellular localization studies using fluorescent tags

  • Dimerization analysis using SDS-PAGE under non-reducing conditions

  • Notch signaling reporter assays to assess functional impact

This approach has successfully identified key functional residues, demonstrating that H262A and W265A mutations significantly reduce XXYLT1 activity by disrupting substrate binding .

What is the optimal experimental design for investigating XXYLT1 in Notch-related tumorigenesis?

A comprehensive experimental design for investigating XXYLT1 in Notch-related tumorigenesis should incorporate multiple approaches:

Step 1: Cancer genomic analysis

  • Analyze publicly available cancer genomic data (e.g., cBioportal) to identify cancer types with XXYLT1 alterations

  • Focus on lung squamous cell carcinoma and lung adenocarcinoma as priority targets

  • Examine correlation between XXYLT1 status and Notch pathway gene expression

Step 2: Clinical sample analysis

  • Collect matched tumor samples, para-carcinoma tissues, and normal tissues

  • Analyze XXYLT1 methylation status using MassARRAY Spectrometry

  • Measure mRNA expression levels of XXYLT1 and key Notch pathway components

  • Stratify analysis by gender to account for observed sex differences

Step 3: Mechanistic studies

  • Generate XXYLT1 knockout and overexpression cell models

  • Assess impact on Notch pathway activation using reporter assays

  • Examine cellular phenotypes: proliferation, apoptosis, migration

  • Test XXYLT1 variants identified in cancer genomics databases

Experimental design considerations:

  • Use a two-step approach with exploratory and validation cohorts

  • Include gender-balanced sample collection

  • Implement both between-subjects and within-subjects designs

  • Apply Design of Experiments (DoE) principles to maximize information while minimizing resource use

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.