Recombinant Human Zinc-activated ligand-gated ion channel (ZACN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
ZACN; L2; LGICZ; LGICZ1; ZAC; Zinc-activated ligand-gated ion channel; Ligand-gated ion channel zinc-activated 1; Ligand-gated ion-channel receptor L2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-412
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
ZACN
Target Protein Sequence
GFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSML LLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVDQDGHV KLNLALATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVY DLKTQVPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYK VTLLLSYLVLHSSLVQALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGA KSGPSPAPRGEQREHGNPGPHPAEEPSRGVKGSQRSWPETADRIFFLVYVVGVLCTQFVF AGIWMWAACKSDAAPGEAAPHGRRPRL
Uniprot No.

Target Background

Function
Zinc-activated ligand-gated ion channel.
Gene References Into Functions
  1. Analysis of ligand-gated ion-channel receptor L2 in the central nervous system. PMID: 16083862
Database Links

HGNC: 29504

OMIM: 610935

KEGG: hsa:353174

STRING: 9606.ENSP00000334854

UniGene: Hs.714919

Protein Families
Ligand-gated ion channel (TC 1.A.9) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in pancreas, brain, liver, placenta, trachea, kidney, spinal cord, stomach and fetal brain. In the adult brain region expression is detected in the hippocampus, striatum, amygdala and thalamus.

Q&A

Basic Research Questions

  • What is the structural organization of human ZACN and how does it differ from other Cys-loop receptors?

    Human Zinc-activated ion channel (ZAC) is a pentameric ligand-gated ion channel belonging to the Cys-loop receptor superfamily. Recent cryo-electron microscopy reconstructions reveal that hZAC forms symmetrical homo-pentamers with a central ion-conduction pore . Each protomer consists of an extracellular domain (ECD) and a transmembrane domain (TMD), sharing structural similarity with anion-permeable CLRs such as glycine receptors and GABAA receptors .

    A distinctive feature of ZACN is its C-tail that establishes a disulfide bond with the loop M2-M3 in the TMD and occupies what would typically be the canonical neurotransmitter orthosteric site in other mammalian CLRs . Additionally, the tip of the cys-loop creates an unprecedented orthosteric site specific to ZACN . This unique structural arrangement explains why ZACN is activated by ions (Zn²⁺, Cu²⁺) and protons rather than neurotransmitters.

  • What are the primary agonists for ZACN and their relative potencies?

    ZACN is activated by three primary agonists: zinc ions (Zn²⁺), copper ions (Cu²⁺), and protons (H⁺). Electrophysiological studies have characterized their relative potencies and efficacies:

    AgonistPotency Rank OrderEfficacy Rank Order
    H⁺HighestHighest
    Cu²⁺IntermediateLowest
    Zn²⁺LowestIntermediate

    The rank orders for potencies and efficacies are H⁺ > Cu²⁺ > Zn²⁺ and H⁺ > Zn²⁺ > Cu²⁺, respectively . The responses elicited by all three agonists are characterized by low degrees of desensitization, although their activation and decay kinetics differ significantly .

  • What is the tissue distribution of ZACN expression in humans?

    ZACN mRNA is widely expressed across multiple human tissues. Based on current research, ZACN expression has been detected in:

    • Central nervous system: brain (adult and fetal), spinal cord

    • Respiratory system: trachea, lung

    • Endocrine system: thyroid, pancreas

    • Cardiovascular system: heart

    • Digestive system: liver, stomach

    • Urinary system: kidney

    • Reproductive system: prostate

    • Other tissues: skeletal muscle, placenta

    This wide distribution suggests ZACN may have diverse physiological functions across multiple organ systems, although specific roles remain to be fully elucidated.

Advanced Research Questions

Data Analysis and Advanced Methodological Questions

  • How can machine learning approaches be applied to analyze complex ZACN electrophysiological data?

    Advanced machine learning techniques can enhance analysis of complex ZACN electrophysiological data:

    a) Tabular Foundation Models:

    • Recent advances in tabular data analysis using Tabular Prior-data Fitted Networks (TabPFN) can be applied to ZACN datasets

    • TabPFN outperforms traditional methods on datasets with up to 10,000 samples, requiring substantially less training time

    • This approach is particularly valuable for analyzing multidimensional ZACN data where traditional statistical methods may fall short

    b) Data Preprocessing Considerations:

    • Address the slow kinetics of ZACN by extracting multiple features from electrophysiological recordings (activation rate, peak amplitude, steady-state current, desensitization rate)

    • Generate synthetic training datasets based on structural causal models to improve model robustness

    • Implement post-processing techniques such as warping with Kumaraswamy distribution and introducing complex nonlinear distortions to enhance model generalizability

    c) Evaluation Metrics:

    • For classification tasks (e.g., differentiating ZACN variants), use ROC AUC and accuracy

    • For regression tasks (e.g., predicting agonist potency), use R² and negative RMSE

    • Normalize scores per dataset, with 1.0 representing the best and 0.0 the worst performance relative to baseline methods

    Implementation of these advanced analytical approaches can facilitate discovery of subtle functional differences between ZACN variants and identification of novel modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.