Recombinant Human Zinc finger protein-like 1 (ZFPL1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Zinc finger protein-like 1 (ZFPL1) is a conserved integral membrane protein critical for maintaining cis-Golgi integrity and regulating cellular processes such as autophagy and cancer progression. Initially identified as a Golgi phosphoprotein, ZFPL1 interacts with the cis-Golgi matrix protein GM130 and is implicated in structural organization, cargo trafficking, and mitotic regulation . In cancer biology, ZFPL1 has emerged as a biomarker for aggressive prostate cancer (PC), with elevated serum levels correlating with neuroendocrine tumor phenotypes . Recombinant ZFPL1 is widely used in structural and functional studies to elucidate its mechanistic roles in disease.

Maintenance of cis-Golgi Integrity

ZFPL1 stabilizes cis-Golgi membranes by anchoring GM130 to the Golgi matrix. Depletion of ZFPL1 disrupts cis-Golgi architecture, causing:

  • Tubulation of cis-Golgi and intermediate compartment (IC) membranes .

  • Delayed cargo trafficking into the Golgi apparatus .

  • Impaired cis-Golgi reassembly post-brefeldin A treatment .

Regulation of Mitotic Golgi Dynamics

During mitosis, ZFPL1 undergoes phosphorylation, suggesting a role in Golgi fragmentation and reorganization. Its interaction with GM130 ensures proper disassembly/reassembly of Golgi membranes during cell division .

Overexpression in Prostate Cancer

ZFPL1 is upregulated in malignant prostates and correlates with neuroendocrine (NE)/androgen-independent phenotypes:

Tissue TypeZFPL1 ExpressionSerum LevelsSource
Benign prostateLow/negligibleBaseline
Malignant prostateHigh4-fold increase
Prostate cancer cellsSecreted via exosomesElevated in PC

Mechanisms:

  • Exosomal secretion by tumor cells promotes systemic dissemination .

  • PI3K-Akt pathway activation enhances proliferation and invasion .

Functional Impact of ZFPL1 Modulation

ManipulationEffectCancer TypeSource
KnockdownReduced proliferation, increased apoptosisProstate, Gastric
OverexpressionEnhanced invasion, metastasisProstate
Competitive binding (ZFD-FLAG)Induced autophagy, cell deathGastric

Autophagy-Related Cell Death

ZFPL1 knockdown in gastric cancer cells triggers:

  • LC3-II accumulation (autophagosome marker) .

  • Inhibition of glycosylation, disrupting protein stability .

  • Autophagy-dependent apoptosis, rescued by bafilomycin A1 .

Interaction with GM130

The ZFPL1-GM130 complex regulates autophagy through:

  • Competitive binding experiments (ZFD-FLAG overexpression) disrupt interaction, inducing autophagy .

  • Glycosylation impairment reduces cancer cell survival, suggesting therapeutic potential .

Targeting ZFPL1-GM130 Interaction

Disrupting this interaction may:

  • Induce autophagy in cancer cells, promoting cell death .

  • Inhibit glycosylation, impairing protein function and metastasis .

Biomarker Utility

Serum ZFPL1 levels serve as a non-invasive diagnostic for:

  • Aggressive prostate cancer (NE/stem cell phenotypes) .

  • Monitoring treatment response, particularly in androgen-independent cancers .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZFPL1; Zinc finger protein-like 1; Zinc finger protein MCG4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ZFPL1
Target Protein Sequence
MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS
Uniprot No.

Target Background

Function
ZFPL1 (Zinc finger protein-like 1) plays a critical role in maintaining the integrity of the cis-Golgi apparatus and facilitating efficient transport of proteins from the endoplasmic reticulum (ER) to the Golgi. It is involved in preserving the structural integrity of the cis-Golgi, potentially through interactions with GOLGA2/GM130.
Gene References Into Functions
  1. The RING domain is crucial for ZFPL1's functionality. PMID: 30036656
  2. Evidence suggests that ZFPL1 plays a significant role in regulating autophagy in NCIN87 and BGC823 cells. PMID: 28447717
  3. Research indicates that ZFPL1 is essential for maintaining the integrity of the cis-Golgi and achieves this through interactions with GM130. PMID: 18323775
Database Links

HGNC: 12868

KEGG: hsa:7542

STRING: 9606.ENSP00000294258

UniGene: Hs.712317

Protein Families
ZFPL1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Single-pass membrane protein.
Tissue Specificity
Expressed strongly in the exocrine pancreas.

Q&A

What is ZFPL1 and what is its structural organization?

ZFPL1 (Zinc finger protein-like 1) is a conserved and widely expressed integral membrane protein with a predicted molecular weight of 34 kDa. Structurally, it contains two predicted zinc finger domains (ZFDs) in the N-terminus and a C-terminal region that likely corresponds to a transmembrane domain . The second ZFD conforms to the consensus for a ring finger domain. Notably, ZFPL1 has an unusual feature where aspartic acid appears at the fourth predicted zinc coordinating residue in vertebrates, rather than the typical cysteine or histidine found in other species . The predicted zinc coordinating residues of both putative ZFDs are highly conserved across species, although in Drosophila melanogaster, Caenorhabditis elegans, and Arabidopsis thaliana, histidine replaces the aspartic acid found in vertebrates .

To study ZFPL1 structure experimentally, researchers typically use a combination of bioinformatic sequence analysis, recombinant protein expression systems, and structural characterization techniques. Site-directed mutagenesis of predicted zinc-coordinating residues can be employed to confirm functional domains, as demonstrated in studies where mutations to these residues significantly affected protein-protein interactions.

Where is ZFPL1 localized within cellular compartments?

ZFPL1 is predominantly localized to the Golgi apparatus, specifically to the cis-Golgi network. Biochemical analyses have confirmed that ZFPL1 is an integral membrane protein, as it resists extraction with both 1 M KCl and sodium carbonate at pH 11, but can be extracted using the detergent Triton X-100 . Topology studies using protease protection assays indicate that the majority of ZFPL1 is positioned on the cytoplasmic face of the membrane, with its N-terminal domain (containing the zinc finger motifs) extending into the cytosol .

For researchers investigating ZFPL1 localization, immunofluorescence microscopy using specific antibodies against ZFPL1 or tagged recombinant versions (such as ZFPL1-GFP) provides reliable visualization. Co-localization studies with established Golgi markers, particularly cis-Golgi proteins like GM130, help confirm its precise subcellular distribution.

What are the primary interaction partners of ZFPL1?

ZFPL1 directly interacts with GM130, a cis-Golgi matrix protein involved in membrane tethering reactions at the intermediate compartment (IC) and cis-Golgi . This interaction has been validated through multiple experimental approaches:

  • Co-immunoprecipitation assays demonstrate that ZFPL1 and GM130 associate with each other in Golgi membranes, with the interaction being stable enough to be detected after cross-linking and immunoprecipitation under both native and denaturing conditions .

  • Direct binding assays with purified recombinant proteins show that full-length ZFPL1 binds specifically to His-tagged GM130 coiled-coils 4-6, but not to coiled-coil 3 of GM130 or the coiled-coil region of TMF (another Golgi protein) .

  • Yeast two-hybrid analyses confirm that the N-terminal region of ZFPL1 containing the two predicted ZFDs interacts with GM130, particularly with coiled-coil 6 .

The binding interface has been mapped through mutational analysis:

  • The first zinc finger motif of ZFPL1 appears to be the primary GM130-binding site

  • Mutation of either ZFD significantly reduces binding to GM130 in co-immunoprecipitation experiments

  • Both ZFDs are required for stable or high-affinity binding

For researchers studying ZFPL1 interactions, these established techniques provide a methodological framework for investigating potential new binding partners or further characterizing known interactions.

How does ZFPL1 contribute to cis-Golgi structural integrity?

ZFPL1 plays a crucial role in maintaining cis-Golgi integrity through multiple mechanisms. Depletion of ZFPL1 using RNAi leads to several structural defects:

  • Mislocalization of GM130 to the intermediate compartment (IC)

  • Increased tubulation of cis-Golgi and IC membranes

  • Inhibition of cis-Golgi assembly following Brefeldin A (BFA) washout

The GM130-positive tubules observed in ZFPL1-depleted cells typically emanate from the Golgi region and contain cis-Golgi proteins but lack markers of later Golgi compartments. This suggests that ZFPL1 specifically maintains the structural organization of the cis-face of the Golgi apparatus .

Mechanistically, ZFPL1 appears to function by promoting the assembly of Golgi matrix proteins (such as GM130 and GRASP65) into a structural scaffold that supports cis-Golgi membrane organization. In the absence of ZFPL1, these matrix proteins accumulate in the IC, indicating their reduced retention in the cis-Golgi .

To study this function experimentally, researchers should:

  • Use RNAi-mediated depletion of ZFPL1 followed by immunofluorescence analysis of Golgi morphology

  • Perform rescue experiments with wild-type ZFPL1 and mutant versions (particularly those with defective GM130 binding)

  • Conduct live-cell imaging to visualize the dynamics of tubulation in ZFPL1-depleted cells

  • Employ BFA washout assays to assess Golgi reassembly kinetics

What role does ZFPL1 play in ER to Golgi transport?

ZFPL1 is required for efficient trafficking between the endoplasmic reticulum (ER) and Golgi apparatus. Experimental evidence for this role comes from trafficking assays using VSV-G (vesicular stomatitis virus G protein) as a cargo marker:

  • In cells depleted of ZFPL1, there is a reduction in the amount of endoglycosidase H (EndoH)-resistant VSV-G compared to controls, indicating an inhibition of trafficking to the Golgi apparatus .

  • The trafficking delay is most noticeable at earlier time points, suggesting that ZFPL1 depletion causes a transport delay rather than a complete block .

  • Cell-surface biotinylation assays confirm that delivery of VSV-G to the plasma membrane is reduced in ZFPL1-depleted cells compared to controls .

Time after temperature shiftEndoH-resistant VSV-G (%)
Control
30 minutes~40
60 minutes~70
120 minutes~85

Note: Values approximated from experimental data described in search results

The mechanism behind this trafficking defect may be linked to the structural impairment of the cis-Golgi in ZFPL1-depleted cells, which could make it less able to accept incoming IC carriers. Additionally, since GM130 participates in the tethering and fusion of IC elements required for their incorporation into the cis-Golgi, ZFPL1's interaction with GM130 may directly contribute to this process .

For researchers studying ZFPL1's role in trafficking, cargo transport assays using temperature-sensitive VSV-G or other trafficking markers, combined with pulse-chase analyses and live-cell imaging, provide effective methodological approaches.

How is ZFPL1 regulated during the cell cycle?

ZFPL1 undergoes mitosis-specific phosphorylation, suggesting cell cycle-dependent regulation of its function. Multiple lines of evidence support this:

  • ZFPL1 is heavily phosphorylated in mitotic but not interphase Golgi membranes treated with mitotic cytosol, as demonstrated by 32P labeling and immunoprecipitation .

  • In vivo studies with cells stably expressing ZFPL1-GFP confirm that the protein incorporates 32P in mitotic but not interphase cells .

This mitotic phosphorylation of ZFPL1 aligns with the well-established disassembly of the Golgi apparatus during cell division. Since ZFPL1 is involved in maintaining cis-Golgi integrity, its phosphorylation may contribute to Golgi disassembly by modulating its interaction with GM130 or other binding partners.

Researchers investigating ZFPL1 regulation should consider:

  • Using phospho-specific antibodies or phosphoproteomic approaches to identify specific phosphorylation sites

  • Employing site-directed mutagenesis to create phosphomimetic and phospho-resistant ZFPL1 variants

  • Analyzing the effect of these mutations on ZFPL1's interaction with GM130 and on Golgi morphology

  • Studying the kinases and phosphatases that regulate ZFPL1 phosphorylation status

What experimental approaches are most effective for studying ZFPL1-GM130 interactions?

To study the interaction between ZFPL1 and GM130, researchers have successfully employed multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): This approach has effectively demonstrated the association between ZFPL1 and GM130 in cellular contexts. For more stable detection, chemical cross-linking prior to membrane extraction and immunoprecipitation has proven useful .

  • Direct binding assays with purified recombinant proteins: This in vitro approach provides the strongest evidence for direct interaction. Full-length ZFPL1 specifically binds to His-tagged GM130 coiled-coils 4-6, confirming direct physical interaction between the proteins .

  • Yeast two-hybrid analysis: This technique has been valuable for mapping interaction domains, showing that the N-terminal region of ZFPL1 containing the ZFDs interacts with GM130, particularly with coiled-coil 6 .

  • Mutational analysis: Introducing mutations in predicted functional domains helps identify critical residues for the interaction. Mutation of zinc-coordinating residues in the first ZFD abolishes GM130 binding in yeast two-hybrid assays, while in the more stringent Co-IP assays, mutation of either ZFD significantly reduces binding .

  • Truncation constructs: Using truncated versions of both proteins has helped map the binding regions. For GM130, constructs containing coiled-coils 4-6 or coiled-coil 6 alone bind to ZFPL1, while for ZFPL1, the N-terminal region containing the ZFDs is sufficient for GM130 binding .

For optimal results, researchers should consider combining these approaches to establish both the occurrence of the interaction in cellular contexts and its direct nature through in vitro studies.

What is the potential role of ZFPL1 in cancer biology?

Recent research suggests that ZFPL1 may have implications in cancer biology, particularly in prostate cancer (PCa). According to emerging data:

  • Modulation of ZFPL1 expression in PC-3 prostate cancer cells significantly alters the rate of cell proliferation, invasion, and apoptosis .

  • ZFPL1 appears to influence the activation of the PI3K-Akt pathway, a central signaling pathway involved in tumor growth .

  • In vivo studies in mouse models have demonstrated reduced tumor growth upon ZFPL1 inhibition, corroborating in vitro findings .

  • ZFPL1 has shown potential as a biomarker for prostate cancer, reportedly outperforming PSA (Prostate-Specific Antigen) in most criteria for a PCa biomarker .

For researchers investigating ZFPL1's role in cancer:

  • Gene knockdown and overexpression studies in cancer cell lines can help determine functional effects

  • Signaling pathway analyses focusing on PI3K-Akt and related pathways should be prioritized

  • Examination of tissue samples from cancer patients for ZFPL1 expression levels may reveal clinical correlations

  • Development of specific inhibitors targeting ZFPL1 or its interactions could provide therapeutic avenues

It's important to note that this cancer-related research on ZFPL1 appears to be relatively recent, and further validation studies are needed to fully establish its role in oncogenesis and potential as a therapeutic target.

How do mutations in ZFPL1's zinc finger domains affect its function?

Mutations in ZFPL1's zinc finger domains significantly impact its function, primarily through altering its interaction with GM130. Experimental evidence shows:

  • Mutation of the predicted zinc-coordinating residues in the first zinc finger motif abolishes GM130 binding in yeast two-hybrid assays, while mutation of the ring domain (second ZFD) has no effect on binding in this assay system .

  • In co-immunoprecipitation experiments, which are generally more stringent than yeast two-hybrid assays, mutation of either ZFD significantly reduces binding to GM130, suggesting both domains contribute to stable or high-affinity binding .

  • In rescue experiments, wild-type ZFPL1-GFP can restore normal Golgi morphology and function in ZFPL1-depleted cells, but ZFD mutants defective in GM130 binding fail to rescue the phenotype .

These findings indicate that while the first ZFD is likely the primary GM130-binding site, both ZFDs are required for optimal ZFPL1 function in maintaining cis-Golgi integrity.

For researchers studying ZFPL1 mutants:

  • Site-directed mutagenesis targeting specific zinc-coordinating residues provides insight into structure-function relationships

  • Rescue experiments with mutant variants help establish the functional significance of specific domains

  • Combining binding assays with functional studies connects biochemical properties to cellular effects

What are the challenges in producing recombinant ZFPL1 for research purposes?

Producing recombinant ZFPL1 presents several challenges that researchers should consider:

  • Membrane protein expression: As an integral membrane protein, ZFPL1 can be difficult to express in soluble form. When the full transmembrane domain is included, expression systems may require detergent solubilization or membrane mimetics.

  • Zinc finger domain integrity: The presence of two zinc finger domains requires proper folding and zinc coordination for functional activity. Expression conditions must maintain the structural integrity of these domains, potentially requiring supplementation with zinc and reducing agents.

  • Protein-protein interaction studies: For interaction studies with GM130 or other partners, researchers have successfully used truncated constructs focusing on the N-terminal cytoplasmic domain containing the ZFDs . This approach circumvents some challenges associated with full-length membrane protein expression.

  • Post-translational modifications: ZFPL1 undergoes phosphorylation, particularly during mitosis . For studies requiring properly modified protein, expression systems capable of reproducing these modifications may be necessary.

Based on published methods, successful approaches have included:

  • Expression of full-length ZFPL1 with C-terminal tags (such as GFP) for cellular studies

  • Production of recombinant N-terminal fragments containing the ZFDs for binding studies

  • Use of bacterial expression systems for interaction domains and mammalian expression for full-length protein

What techniques are most effective for analyzing ZFPL1 depletion effects on Golgi morphology?

To analyze the effects of ZFPL1 depletion on Golgi morphology, researchers should employ a combination of techniques:

  • RNAi-mediated depletion: siRNA targeting ZFPL1 has been effectively used to deplete the protein in cultured cells. Using multiple siRNA sequences helps confirm specificity of observed phenotypes .

  • Immunofluorescence microscopy: This technique allows visualization of changes in Golgi morphology following ZFPL1 depletion. Co-staining with markers for different Golgi compartments (cis, medial, trans) helps distinguish specific effects on different regions of the Golgi .

  • Live-cell imaging: For dynamic analysis of Golgi tubulation and trafficking, live-cell imaging of cells expressing fluorescently tagged Golgi markers provides temporal resolution of morphological changes.

  • Brefeldin A (BFA) washout assays: BFA treatment causes Golgi disassembly, and washout allows observation of reassembly kinetics. This approach has revealed that ZFPL1 depletion specifically impairs cis-Golgi reassembly without affecting later Golgi compartments .

  • Rescue experiments: Expression of RNAi-resistant wild-type ZFPL1 or mutant versions helps establish causality and domain requirements. The observation that wild-type ZFPL1 but not GM130-binding mutants can rescue Golgi defects confirms the specificity and mechanism of ZFPL1 function .

  • Electron microscopy: For ultrastructural analysis, electron microscopy provides detailed insights into Golgi membrane organization that cannot be resolved by light microscopy.

These methodologies, particularly when combined, provide robust approaches for characterizing the role of ZFPL1 in maintaining Golgi structure and function.

How can researchers assess ZFPL1's impact on cargo trafficking pathways?

To evaluate ZFPL1's influence on cargo trafficking, several methodological approaches have proven effective:

  • VSV-G trafficking assays: The temperature-sensitive variant of VSV-G provides a synchronized wave of cargo that can be followed from the ER to the Golgi and then to the plasma membrane. Two complementary methods to track this movement include:

    • Endoglycosidase H (EndoH) resistance assays, which monitor acquisition of Golgi-specific glycosylation

    • Cell-surface biotinylation, which directly measures arrival at the plasma membrane independent of glycosylation status

  • Pulse-chase experiments: These allow quantitative measurement of protein transit through the secretory pathway and can reveal kinetic delays in trafficking.

  • Live-cell imaging with fluorescent cargo: This approach provides real-time visualization of trafficking dynamics and can reveal specific steps affected by ZFPL1 depletion.

  • Correlative analysis with Golgi morphology: Combining trafficking assays with morphological analysis helps establish connections between structural defects and functional impairments.

In ZFPL1-depleted cells, these methods have revealed a reduction in the rate of cargo delivery to the Golgi apparatus, with effects most pronounced at earlier time points, suggesting a transport delay rather than a complete block .

What approaches are recommended for studying ZFPL1 phosphorylation?

To investigate ZFPL1 phosphorylation, particularly its mitosis-specific regulation, researchers should consider these methodological approaches:

  • Metabolic labeling with 32P: This approach has successfully demonstrated mitosis-specific phosphorylation of ZFPL1. Cells synchronized in mitosis or interphase are labeled with 32P, followed by immunoprecipitation of ZFPL1 and detection of incorporated radioactivity .

  • In vitro phosphorylation assays: Incubation of purified Golgi membranes with interphase or mitotic cytosol in the presence of 32P-ATP, followed by immunoprecipitation of ZFPL1, can reveal cell cycle-dependent phosphorylation events .

  • Phospho-specific antibodies: Development of antibodies recognizing specific phosphorylated residues of ZFPL1 would facilitate detection of phosphorylation without radioactive labeling.

  • Mass spectrometry: Phosphoproteomic analysis of immunoprecipitated ZFPL1 can identify specific phosphorylation sites and potentially quantify phosphorylation levels.

  • Phosphomimetic and phospho-resistant mutants: Once phosphorylation sites are identified, creating mutants where phosphorylated residues are replaced with acidic residues (phosphomimetic) or non-phosphorylatable residues helps establish the functional significance of phosphorylation.

  • Kinase inhibitor studies: Using specific inhibitors of mitotic kinases can help identify the kinases responsible for ZFPL1 phosphorylation.

These approaches provide complementary information about the regulation, sites, and functional consequences of ZFPL1 phosphorylation during the cell cycle.

What are the promising areas for further investigation of ZFPL1 function?

Several promising directions for future ZFPL1 research emerge from current findings:

  • Detailed structural characterization: While the domain organization of ZFPL1 has been predicted, high-resolution structural studies using X-ray crystallography or cryo-electron microscopy would provide deeper insights into its functional mechanisms, particularly regarding the zinc finger domains and their interaction with GM130.

  • Comprehensive interactome analysis: Beyond GM130, ZFPL1 likely interacts with additional proteins in the Golgi and possibly other cellular compartments. Proteomic approaches such as BioID, proximity labeling, or comprehensive immunoprecipitation followed by mass spectrometry could reveal the full range of ZFPL1 binding partners.

  • Physiological relevance in tissue-specific contexts: While ZFPL1 is widely expressed, its function may have tissue-specific importance. Studies in specialized secretory cells or tissues with high secretory demands might reveal unique roles.

  • Role in human disease: The emerging connection between ZFPL1 and cancer warrants further investigation, as does potential involvement in other diseases, particularly those affecting the secretory pathway.

  • Regulatory mechanisms beyond phosphorylation: While mitotic phosphorylation has been established, other post-translational modifications and regulatory mechanisms affecting ZFPL1 function remain to be explored.

Researchers pursuing these directions will contribute significantly to our understanding of this protein's role in cellular function and potentially identify new therapeutic targets for diseases involving the secretory pathway or cancer.

How might ZFPL1 research contribute to understanding broader Golgi biology?

ZFPL1 research has significant potential to advance our understanding of fundamental Golgi biology in several ways:

  • Golgi structural organization: ZFPL1's role in maintaining cis-Golgi integrity through interaction with matrix proteins provides insights into how the Golgi maintains its complex architecture. Further studies may reveal general principles of Golgi compartmentalization and structural maintenance.

  • ER-Golgi trafficking mechanisms: The observation that ZFPL1 depletion affects cargo transport efficiency suggests its involvement in trafficking mechanisms. Deeper investigation may elucidate novel aspects of vesicle tethering, docking, or fusion at the cis-Golgi.

  • Mitotic Golgi fragmentation and reassembly: As a mitotically phosphorylated protein , ZFPL1 may contribute to our understanding of how the Golgi apparatus disassembles during mitosis and reassembles afterward. This fundamental process remains incompletely understood despite decades of research.

  • Golgi stress responses: Investigating how cells respond to ZFPL1 depletion may reveal adaptive mechanisms that maintain Golgi function under stress conditions.

  • Evolution of Golgi organization: Comparative studies of ZFPL1 across species could provide insights into the evolution of Golgi structure and function, as the protein is conserved but shows interesting variations in key residues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.