Recombinant Human Zinc transporter 10 (SLC30A10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All protein shipments default to normal blue ice packs. If you require dry ice shipping, please communicate this in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC30A10; ZNT10; ZNT8; Zinc transporter 10; ZnT-10; Manganese transporter SLC30A10; Solute carrier family 30 member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-485
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC30A10
Target Protein Sequence
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV NRTHF
Uniprot No.

Target Background

Function
SLC30A10, also known as Zinc transporter 10, plays a crucial role in manganese transport. Manganese is an essential cation required for the function of various enzymes, including those critical for neurotransmitter metabolism and neuronal metabolic pathways. However, elevated manganese levels can be cytotoxic, inducing oxidative stress, mitochondrial dysfunction, and apoptosis. SLC30A10 acts as a manganese efflux transporter, protecting against manganese-induced cell death. It also serves as a zinc transporter involved in zinc homeostasis. SLC30A10 facilitates zinc transport into early endosomes and recycling endosomes, preventing zinc toxicity. This function may be regulated by heterodimerization with other zinc transporters belonging to the SLC30A subfamily. The SLC30A3:SLC30A10 heterodimer plays a role in zinc transport-dependent regulation of the EGFR/ERK transduction pathway in endosomes. SLC30A10 may also participate in regulating zinc-dependent senescence of vascular smooth muscle cells.
Gene References Into Functions
  1. Structural homology analysis suggests that the L349P mutation causes significant structural changes in the CTD domain of ZnT-10, leading to reduced function. PMID: 27550551
  2. SLC30A10 has a protective role against 1-methyl-4-phenylpyridinium-induced toxicity via the PERK-ATF4 pathway. PMID: 28688763
  3. Expression of either wild-type or mutant forms of SLC30A10 effectively inhibited the effect of ATP2C1 in response to manganese challenge in both zebrafish embryos and HeLa cells. These findings indicate that either activating ATP2C1 or restoring manganese-induced trafficking of ATP2C1 can reduce manganese accumulation, suggesting a potential therapeutic target for treating HMDPC. PMID: 28692648
  4. Results suggest that residues in the transmembrane and C-terminal domains contribute to optimal manganese transport by SLC30A10. Furthermore, the mechanism of ion coordination in the transmembrane domain of SLC30A10 might differ significantly from that in YiiP/other SLC30 proteins. PMID: 27307044
  5. The allele was associated with increased sway velocity (15%, P = .033; adjusted for age and sex) and reduced SLC30A10 expression. PMID: 26628504
  6. Early disease manifestations (including videos) are described in five previously unreported Indian children carrying novel homozygous SLC30A10 mutations. PMID: 25778823
  7. SLC30A10 is a cell surface-localized manganese efflux transporter that reduces manganese levels and protects against manganese toxicity. PMID: 25319704
  8. These findings suggest that both the upregulation of ZIP14 and the downregulation of ZnT10 by IL-6 might have enhanced manganese accumulation in SH-SY5Y cells. PMID: 24576911
  9. A case of inherited manganism caused by an SLC30A10 mutation is presented. PMID: 23369405
  10. ZnT10 is significantly decreased in the frontal cortex in Alzheimer's disease. PMID: 23741496
  11. This review addresses manganese transport proteins, newly discovered SLC30A10 mutations, and their implications for Parkinsonism and manganese regulation. PMID: 23357421
  12. The study demonstrates downregulation by zinc of ZnT10 mRNA levels in cultured intestinal and neuroblastoma cell lines and reduced transcription from the ZnT10 promoter at an elevated extracellular zinc concentration. PMID: 22706290
  13. SLC30A10 mutations cause a treatable recessive disease with a pleomorphic phenotype, providing compelling evidence that SLC30A10 plays a critical role in manganese transport. PMID: 22341971
  14. This work has confirmed that SLC30A10 functions as a manganese transporter in humans that, when defective, causes manganese accumulation in the liver and brain. PMID: 22341972
  15. The study identified the full-length sequences of SLC30A10, expanding the SLC30 family to ten members. They employed an expressed sequence tag (EST) data mining strategy to determine the pattern of ZnT gene expression in tissues. PMID: 15154973

Show More

Hide All

Database Links

HGNC: 25355

OMIM: 611146

KEGG: hsa:55532

STRING: 9606.ENSP00000355893

UniGene: Hs.284450

Involvement In Disease
Hypermanganesemia with dystonia 1 (HMNDYT1)
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Recycling endosome. Early endosome.
Tissue Specificity
Specifically expressed in fetal liver and fetal brain. Expressed in adult tissues with relative levels small intestine > liver > testes > brain > ovary > colon > cervix > prostate > placenta.

Q&A

What is the primary substrate specificity of SLC30A10 despite its classification as a zinc transporter?

SLC30A10, despite belonging to the SLC30 (ZnT) family traditionally associated with zinc transport, functions primarily as a manganese efflux transporter rather than a zinc transporter. Extensive evidence from knockout mice studies shows that SLC30A10 deficiency leads to markedly elevated manganese levels in the brain, liver, blood, and thyroid, while zinc levels remain largely unchanged in most tissues . This substrate specificity has been confirmed through multiple experimental approaches including cell culture studies, animal models, and clinical observations in patients with SLC30A10 mutations. The dramatic 20-40 fold elevations in tissue manganese levels observed in SLC30A10 knockout mice provide compelling evidence for its essential role in manganese detoxification .

From a physiological perspective, SLC30A10's manganese specificity appears to be an evolutionary adaptation to provide protection against manganese toxicity. Unlike some transporters that handle multiple metal ions, SLC30A10 displays remarkable selectivity for manganese over zinc. This selectivity is particularly important given the neurotoxic effects of manganese when present at elevated concentrations, especially in the basal ganglia. The protein's localization to the cell surface enables it to directly regulate cellular manganese efflux into the extracellular space, making it a critical component of the body's manganese detoxification system.

How does the subcellular localization of SLC30A10 influence its functional role?

SLC30A10 primarily localizes to the plasma membrane where it mediates the efflux of manganese from the cytoplasm to the extracellular environment, distinguishing it from several other ZnT family members that predominantly localize to intracellular compartments. This cell surface localization is critical for its function in expelling excessive manganese from cells. In polarized cells such as intestinal enterocytes, SLC30A10 exhibits specific targeting to the apical/luminal domain, as demonstrated in differentiated CaCo2 cells . This polarized distribution enables directional transport of manganese across epithelial barriers and is essential for manganese excretion from the body.

Experiments with CaCo2 cells reveal that before differentiation, SLC30A10 distributes across the entire cell surface, but upon differentiation, it becomes concentrated at the apical domain alongside F-actin . This strategic localization allows SLC30A10 to transport manganese from enterocytes into the intestinal lumen, facilitating elimination of the metal from the body. The polarized localization in enterocytes explains why intestinal SLC30A10 plays a crucial role in systemic manganese homeostasis beyond what might be expected based solely on its expression levels. This subcellular targeting is likely governed by specific trafficking signals within the SLC30A10 protein sequence, similar to how alternative C-terminal sequences dictate differential targeting of ZnT5 variants to either the Golgi apparatus or endoplasmic reticulum .

What are the consequences of SLC30A10 dysfunction in humans?

Loss-of-function mutations in SLC30A10 cause an inherited disorder of manganese metabolism characterized by hypermanganesemia, dystonia, polycythemia, and liver cirrhosis. This condition represents the first identified inherited disorder of manganese metabolism with neurotoxicity in humans . Patients with SLC30A10 mutations exhibit markedly elevated manganese levels in the brain, liver, and blood despite no history of environmental manganese overexposure . The neurological manifestations predominantly affect the extrapyramidal system, with dystonia, parkinsonism, and other movement disorders reflecting manganese accumulation in the basal ganglia.

Autopsy findings from a patient with SLC30A10 mutation revealed neuronal loss specifically in the globus pallidus , a pattern that parallels the neurodegeneration observed in cases of occupational manganese overexposure. This pathological similarity suggests shared mechanisms of neurotoxicity. Beyond neurological symptoms, patients develop polycythemia (increased red blood cell production) and progressive liver disease leading to cirrhosis. The multisystem nature of the disorder reflects SLC30A10's importance in maintaining manganese homeostasis across various tissues. Notably, SNPs in SLC30A10 have been associated with altered blood manganese levels and neurological function even in the general population , suggesting that subtle variations in SLC30A10 function may influence manganese homeostasis and neurological health across a broader spectrum than previously recognized.

What expression systems and purification strategies are optimal for recombinant SLC30A10 production?

For recombinant expression of human SLC30A10, mammalian expression systems generally provide the most physiologically relevant environment for proper protein folding and post-translational modifications. HEK293 cells represent a commonly used system for membrane protein expression and have been successfully employed for other ZnT family members. For visualization and purification purposes, epitope tags such as FLAG or polyhistidine can be incorporated, though care must be taken to ensure these additions don't interfere with transport function. Based on approaches used for other transporters in the search results, fusion constructs with GFP or FLAG tags have proven effective for tracking protein localization while maintaining functionality .

For biochemical and structural studies requiring larger quantities of purified protein, insect cell expression systems such as Sf9 or Hi5 cells offer advantages due to their higher expression yields compared to mammalian systems. The purification of SLC30A10, like other membrane proteins, typically involves solubilization with detergents followed by affinity chromatography using the incorporated epitope tag. For structural studies similar to those performed with ZnT1 , selection of appropriate detergents or reconstitution into nanodiscs or lipid environments that maintain the native conformation is critical. The purification protocol should include steps to remove metal ions from buffers if metal-free states are desired, or controlled addition of manganese for studies of the metal-bound transporter.

What functional assays can quantitatively measure SLC30A10 transport activity?

Several complementary approaches can be employed to assess SLC30A10 transport activity quantitatively. Cell-based manganese efflux assays provide one of the most direct measures of SLC30A10 function. The pulse-chase experimental design described for CaCo2 cells offers an excellent methodological framework . In this approach, cells expressing SLC30A10 are first loaded with manganese (typically 12.5 μM for 16 hours), followed by incubation in manganese-free media. Metal content in both cells and media is then measured using analytical techniques such as inductively coupled plasma mass spectrometry (ICP-MS). This experimental design allows researchers to quantify both the reduction in intracellular manganese and the increase in extracellular manganese mediated by SLC30A10.

For polarized cell systems like differentiated CaCo2 cells, the experimental setup can be modified to distinguish between apical and basolateral transport by separately analyzing media from each compartment. This approach revealed that SLC30A10 mediates manganese release specifically into the apical/luminal compartment, consistent with its role in intestinal manganese excretion . Alternative approaches include using fluorescent metal-sensitive probes that can detect changes in cellular manganese levels in real-time, though these require careful calibration due to potential cross-reactivity with other divalent metals. For higher throughput applications, cell viability assays in the presence of toxic manganese concentrations can serve as an indirect measure of SLC30A10 activity, with cells expressing functional SLC30A10 showing enhanced survival compared to controls.

How should researchers approach creating and validating SLC30A10 knockout models?

When generating SLC30A10 knockout models, researchers must carefully consider whether whole-body or tissue-specific approaches will best address their specific research questions. For whole-body knockouts, CRISPR-Cas9 genome editing offers precision in creating targeted gene disruptions. Based on the knockout approaches described in search result , researchers should design guide RNAs targeting early exons to create frameshift mutations that effectively abolish protein expression. For conditional knockout models that allow tissue-specific or inducible deletion, the Cre-loxP system has proven effective. This approach requires generating mice with loxP sites flanking critical exons of SLC30A10 (floxed alleles), which can then be crossed with appropriate Cre-expressing lines for tissue-specific deletion.

Rigorous validation of SLC30A10 knockout models should employ multiple complementary approaches. Genomic PCR can confirm the presence of the targeted mutation or recombined (knockout) allele in the appropriate tissues. As demonstrated in the validation of tissue-specific knockouts, the recombined allele should be detected only in tissues expressing the Cre recombinase . RT-PCR and quantitative RT-PCR provide essential confirmation of reduced SLC30A10 mRNA levels in targeted tissues. For SLC30A10, protein-level validation can be challenging due to the limited availability of specific antibodies for the rodent protein, as noted in search result . Most importantly, functional validation through measurement of tissue manganese levels using ICP-MS provides crucial evidence of the physiological impact of SLC30A10 knockout, with elevated manganese levels expected in affected tissues.

What cellular pathways mediate manganese neurotoxicity in SLC30A10 deficiency?

The neurotoxicity resulting from SLC30A10 deficiency involves multiple cellular pathways that collectively contribute to neuronal dysfunction and death. At the cellular level, excessive manganese disrupts mitochondrial function by interfering with electron transport chain complexes and inducing oxidative stress through increased production of reactive oxygen species. The predilection for toxicity in the basal ganglia, particularly the globus pallidus as observed in autopsy findings from a patient with SLC30A10 mutation , suggests region-specific vulnerability factors. This pattern of neurodegeneration parallels that seen in occupational manganese overexposure, indicating shared pathophysiological mechanisms despite different routes of manganese accumulation.

How do different tissues contribute to systemic manganese homeostasis in SLC30A10 knockout models?

Studies of tissue-specific SLC30A10 knockout models have revealed unexpected insights into how different tissues contribute to systemic manganese homeostasis. Contrary to initial expectations, brain-specific knockout of SLC30A10 (using Nes-Cre) did not significantly alter brain manganese levels under basal conditions, suggesting that neuronal/glial SLC30A10 is not essential for maintaining normal brain manganese homeostasis . Liver-specific knockout (using Alb-Cre) resulted in modest 1.5-2.5 fold elevations in brain, liver, and blood manganese levels . Most strikingly, whole-body SLC30A10 knockout led to dramatic 20-40 fold increases in manganese across these tissues . This disparity between tissue-specific and whole-body knockouts reveals that SLC30A10 expression in tissues beyond the brain and liver plays a critical role in manganese homeostasis.

The intestine emerged as a key site of SLC30A10 action, with experiments in differentiated CaCo2 cells demonstrating that SLC30A10 localizes to the apical/luminal domain of enterocytes and mediates manganese efflux into the intestinal lumen . This finding indicates that intestinal SLC30A10 functions critically in manganese excretion from the body. The coordinated action of SLC30A10 across multiple tissues creates a network of manganese regulation: liver SLC30A10 likely facilitates manganese excretion via bile, intestinal SLC30A10 prevents absorption and promotes excretion into the gut lumen, while brain SLC30A10 may serve a protective function under conditions of manganese excess rather than contributing significantly to basal manganese levels. This interplay between tissue-specific functions explains why global SLC30A10 deficiency produces more severe phenotypes than tissue-specific knockouts.

How might environmental factors interact with SLC30A10 function to influence manganese toxicity risk?

Environmental factors likely interact with SLC30A10 function in complex ways that modulate individual susceptibility to manganese toxicity. Occupational or environmental exposure to manganese represents the most direct environmental factor that would challenge the manganese efflux capacity provided by SLC30A10. Individuals with reduced SLC30A10 function, whether due to genetic variants or other factors affecting expression or activity, would likely show increased susceptibility to environmentally-derived manganese. The association between SNPs in SLC30A10 and altered blood manganese levels in the general population supports this gene-environment interaction model, suggesting that genetic variation in SLC30A10 could represent a risk factor for manganese neurotoxicity from environmental exposures.

Dietary factors also likely influence the relationship between SLC30A10 function and manganese homeostasis. Iron deficiency enhances manganese absorption from the gastrointestinal tract and may therefore increase the manganese load that must be managed by SLC30A10-mediated efflux systems. Consequently, iron deficiency might exacerbate the phenotypic effects of SLC30A10 dysfunction. Similarly, high dietary manganese intake would increase the burden on SLC30A10-dependent detoxification mechanisms. Other environmental factors that could potentially interact with SLC30A10 function include exposure to other metals that might compete with or influence manganese transport, and environmental toxins that affect mitochondrial function or oxidative stress pathways, potentially lowering the threshold for manganese-induced cellular dysfunction when SLC30A10 function is compromised.

What imaging techniques can effectively visualize SLC30A10 localization and trafficking?

Multiple complementary imaging techniques can be employed to visualize SLC30A10 localization and trafficking in various cellular systems. Confocal microscopy using fluorescently tagged SLC30A10 constructs provides a powerful approach for examining subcellular localization patterns in living cells. Based on methods applied to other transporters in the search results, fusion of GFP to either the N- or C-terminus of SLC30A10 can generate functional tagged proteins suitable for visualization . For studying polarized cells like intestinal enterocytes, confocal microscopy with Z-stack imaging allows three-dimensional reconstruction to distinguish between apical and basolateral localization, as demonstrated in the CaCo2 cell experiments with SLC30A10 .

For higher resolution imaging of SLC30A10 localization, super-resolution microscopy techniques such as stimulated emission depletion (STED) microscopy or stochastic optical reconstruction microscopy (STORM) can provide nanoscale visualization of transporter distribution. To study dynamic aspects of SLC30A10 trafficking, fluorescence recovery after photobleaching (FRAP) or photoactivation approaches can reveal how quickly the transporter moves within the membrane or between subcellular compartments. For examining endogenous SLC30A10 in tissues or cells where overexpression might alter normal trafficking patterns, immunofluorescence microscopy with specific antibodies represents the method of choice, though the development of antibodies with high specificity for SLC30A10 has been challenging, as noted in search result . Co-localization studies with markers for specific subcellular compartments (plasma membrane, endosomes, Golgi, etc.) are essential for precisely defining the localization pattern of SLC30A10 under various conditions.

What computational approaches can predict structural features and transport mechanisms of SLC30A10?

In the absence of experimentally determined structures for SLC30A10, computational approaches offer valuable insights into its structural features and transport mechanisms. Homology modeling represents a primary approach, leveraging the available structural data from related transporters in the SLC30 family. The cryo-electron microscopy structures of human ZnT1 in different conformational states provide particularly relevant templates for modeling SLC30A10. These models can identify potential manganese binding sites within the transmembrane domains and predict residues involved in conformational changes during the transport cycle. Multiple sequence alignment of SLC30A10 with other ZnT family members can highlight conserved residues likely involved in the core transport mechanism versus divergent residues that might contribute to manganese specificity.

Molecular dynamics (MD) simulations, as employed for ZnT1 in search result , represent a powerful approach for investigating the dynamics of SLC30A10-mediated transport. Starting from homology models, MD simulations can model how manganese ions and potentially coupled protons move through the transport pathway. The simulation setup described for ZnT transporters, including embedding the protein in a lipid bilayer and adding explicit water molecules and ions , provides a methodological framework applicable to SLC30A10. More specialized simulations like free energy calculations can estimate binding affinities for manganese versus other metals, helping explain SLC30A10's substrate specificity. Complementary to these approaches, machine learning methods trained on known protein-metal interactions can predict metal binding sites and coordination geometry. Together, these computational approaches can generate testable hypotheses about SLC30A10 structure and function to guide experimental investigations.

What methods are effective for measuring manganese levels in biological samples from SLC30A10 studies?

Accurate measurement of manganese levels in biological samples is crucial for SLC30A10 research, requiring sensitive analytical techniques due to the relatively low physiological concentrations of this essential trace element. Inductively coupled plasma mass spectrometry (ICP-MS) represents the gold standard for manganese quantification in biological samples, offering detection limits in the parts-per-trillion range. This technique was effectively employed in the SLC30A10 knockout studies to measure manganese levels in tissues and blood . For sample preparation, tissues typically require acid digestion to release metals from the biological matrix, while cell culture samples may be directly diluted in acid. Importantly, rigorous quality control procedures including certified reference materials and spike recovery tests are essential to ensure accuracy.

For researchers without access to ICP-MS, graphite furnace atomic absorption spectroscopy (GFAAS) offers an alternative with suitable sensitivity for most biological applications. While less commonly used now, neutron activation analysis provides excellent sensitivity and specificity for manganese but requires specialized facilities. For measuring changes in cellular manganese levels in real-time, fluorescent metal-sensitive probes can be employed, though these require careful calibration and controls to account for potential cross-reactivity with other divalent metals. Synchrotron-based X-ray fluorescence microscopy represents a specialized technique that can map the spatial distribution of manganese within tissues or cells at submicron resolution, potentially revealing compartmentalization patterns relevant to SLC30A10 function. This approach could be particularly valuable for examining how manganese distribution changes in different tissues of SLC30A10 knockout models.

How do the transport mechanisms of SLC30A10 compare with other manganese and zinc transporters?

SLC30A10 appears to employ a transport mechanism with similarities to other cation diffusion facilitator (CDF) family transporters, including ZnT proteins, but with distinct features that confer manganese specificity. From structural studies of ZnT1 , we can infer that SLC30A10 likely undergoes conformational changes between inward-facing and outward-facing states during the transport cycle. The search results show that ZnT1 exhibits pH-dependent conformational changes, suggesting proton coupling in the transport mechanism . A similar proton-coupled antiport mechanism may operate in SLC30A10, though this requires experimental verification. The manganese specificity of SLC30A10 versus the zinc preference of most other ZnT transporters suggests differences in the metal coordination sites within the transmembrane domains.

In contrast to SLC30A10's role in manganese efflux, transporters like ZIP8 (SLC39A8) and ZIP14 (SLC39A14) mediate cellular manganese uptake. This creates a system analogous to the opposing roles of ZIP and ZnT transporters in zinc homeostasis described in search result , where coordinated activity of transporters moving metal ions in opposite directions is required for proper metal regulation. Unlike SLC30A10, which appears highly specific for manganese, transporters like DMT1 (Divalent Metal Transporter 1) exhibit broader substrate specificity, transporting iron, manganese, and other divalent metals. The functional divergence of SLC30A10 from other ZnT family members to specifically handle manganese represents an interesting case of evolutionary specialization within a transporter family, likely involving specific structural adaptations of the metal binding sites to favor coordination of manganese over zinc.

What lessons from other SLC30 family members can inform SLC30A10 research?

Structural and functional insights from other SLC30 family members provide valuable frameworks for understanding SLC30A10. The cryo-electron microscopy structures of human ZnT1 reveal that it dimerizes through extensive interactions between cytosolic, transmembrane, and extracellular domains . Similar oligomerization may occur with SLC30A10, potentially influencing its transport characteristics or regulation. The conformational dynamics observed in ZnT1, with pH-dependent transitions between outward-facing and inward-facing states , likely apply to SLC30A10 as well, providing a mechanistic model for how the transporter accomplishes manganese movement across the membrane.

The study of ZnT5 splice variants demonstrates how alternative C-terminal sequences can dictate differential subcellular localization to either the Golgi apparatus or endoplasmic reticulum . This example illustrates how protein targeting signals within transporter sequences determine their cellular distribution and consequently their physiological functions. While similar alternative splicing has not been reported for SLC30A10, understanding the molecular determinants of its cell surface localization could benefit from comparative analysis with other ZnT family members. The molecular dynamics simulation approaches used for studying zinc binding and transport in ZnT1 provide methodological frameworks that could be adapted to investigate manganese coordination and transport by SLC30A10. These comparative approaches can bridge knowledge gaps regarding SLC30A10 by leveraging the more extensive characterization available for other SLC30 family members.

How does tissue-specific expression of SLC30A10 compare with other metal transporters?

The tissue distribution pattern of SLC30A10 differs from many other metal transporters, reflecting its specialized role in manganese homeostasis. While not comprehensively detailed in the search results, SLC30A10 exhibits notable expression in tissues involved in manganese excretion, including the liver and intestine . This contrasts with some other ZnT family members that show more ubiquitous expression patterns reflecting the universal cellular requirement for zinc homeostasis. The functional importance of intestinal SLC30A10 for systemic manganese homeostasis, revealed through whole-body versus tissue-specific knockout comparisons , highlights how the physiological significance of a transporter cannot always be predicted solely from its relative expression levels across tissues.

In polarized enterocytes, SLC30A10 localizes specifically to the apical/luminal membrane , positioning it to transport manganese into the intestinal lumen for excretion. This polarized distribution in epithelial cells parallels that of other transporters involved in metal excretion, such as ATP7B (Wilson disease protein) which localizes to the apical membrane of hepatocytes to facilitate copper excretion into bile. The brain expression of SLC30A10 appears less critical for basal manganese homeostasis than might be expected, as brain-specific knockout did not significantly alter brain manganese levels . This suggests that other transport systems may compensate for SLC30A10 loss in the brain under normal conditions, or that SLC30A10 in the brain serves a protective function that becomes important only under conditions of manganese excess.

What are the most pressing questions about SLC30A10 structure-function relationships?

Despite significant advances in understanding SLC30A10's physiological importance, several crucial questions about its structure-function relationships remain unanswered. The molecular basis for SLC30A10's high selectivity for manganese over zinc, despite belonging to a family of zinc transporters, represents a fundamental question. Identifying the specific amino acid residues that coordinate manganese within the transmembrane domains and comparing these with the corresponding regions in zinc-selective ZnT transporters would provide critical insights into the determinants of metal selectivity. Additionally, elucidating whether SLC30A10-mediated manganese transport is coupled to proton movement, similar to the pH-dependent transport observed for ZnT1 , would clarify the energetics of the transport mechanism.

The oligomeric state of functional SLC30A10 also requires investigation. Based on other ZnT transporters like ZnT1 that function as dimers , SLC30A10 may also require dimerization, but this remains to be experimentally confirmed. Structural studies similar to the cryo-electron microscopy approach used for ZnT1 would be invaluable for visualizing SLC30A10 in different conformational states during the transport cycle. Understanding how disease-causing mutations in SLC30A10 specifically disrupt protein folding, trafficking, or transport function would provide insights into structure-function relationships while also informing potential therapeutic approaches. Finally, identifying regions of SLC30A10 responsible for its specific targeting to the apical domain in polarized cells like enterocytes would enhance our understanding of how this transporter is properly positioned to fulfill its physiological role in manganese excretion.

What novel therapeutic approaches might target SLC30A10 for manganese-related disorders?

Therapeutic targeting of SLC30A10 holds promise for addressing both manganese deficiency and toxicity conditions, though different strategies would be required depending on the specific disorder. For inherited hypermanganesemia caused by SLC30A10 mutations, gene therapy approaches delivering functional SLC30A10 cDNA to affected tissues represent a potential curative strategy. The effectiveness of targeting liver and intestine for such approaches is supported by the critical role of these tissues in manganese excretion, as demonstrated in the knockout studies . For missense mutations that impair protein folding or trafficking rather than directly affecting the transport mechanism, pharmacological chaperones that stabilize the mutant protein might increase the fraction of functional SLC30A10 reaching the cell surface.

Beyond the rare inherited disorders, modulating SLC30A10 function could potentially benefit more common conditions associated with manganese dysregulation. In occupational manganese exposure or environmental cases of excess manganese, compounds that enhance SLC30A10 expression or activity could accelerate manganese clearance and reduce neurotoxicity. Conversely, controlled inhibition of SLC30A10 might be beneficial in certain cases of manganese deficiency, though this would require careful tissue targeting to avoid systemic manganese accumulation. The development of small molecule modulators of SLC30A10 would be greatly facilitated by high-resolution structural information and functional assays suitable for compound screening. Additionally, identifying the regulatory mechanisms controlling SLC30A10 expression could reveal indirect approaches to modulate its activity through pathways that naturally respond to manganese status.

How might SLC30A10 research contribute to understanding neurodegenerative diseases?

The study of SLC30A10 opens new avenues for understanding the role of manganese dyshomeostasis in neurodegenerative diseases beyond the rare inherited disorders directly caused by SLC30A10 mutations. Manganese has been implicated in several neurodegenerative conditions, including Parkinson's disease where environmental manganese exposure is a recognized risk factor. Given that SNPs in SLC30A10 are associated with altered neurological function in the general population , subtle variations in SLC30A10 activity might influence susceptibility to manganese-related neurodegeneration. Investigating whether SLC30A10 expression or function is altered in common neurodegenerative diseases could reveal previously unrecognized connections between manganese homeostasis and disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.