Recombinant Human Zinc transporter 3 (SLC30A3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC30A3; ZNT3; Zinc transporter 3; ZnT-3; Solute carrier family 30 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC30A3
Target Protein Sequence
MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPL PPPGLTPERLHARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSL FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAM LLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLGNTSVRAAFVHVL GDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNV GFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF GFSSCTLQVEQYQPEMAQCLRCQEPPQA
Uniprot No.

Target Background

Function
Involved in the accumulation of zinc within synaptic vesicles.
Gene References Into Functions

Functional Studies of SLC30A3 (ZnT3):

  1. ZNT3 expression was detected in human, but not mouse, beta-cells. (PMID: 29372370)
  2. Single nucleotide polymorphisms (SNPs) in the SLC30A3 gene and its surrounding region are associated with schizophrenia in females, but not males. (PMID: 27750116)
  3. Significantly reduced ZnT3 protein levels were observed in the prefrontal cortex of individuals with major depressive disorder compared to controls. (PMID: 27661418)
  4. SLC30A3 knockdown cells showed attenuated ERK1/2 phosphorylation increases in response to tunicamycin treatment, suggesting a role for SLC30A3 in mitigating cellular stress, such as ER stress, via the ERK1/2 pathway. (PMID: 27678294)
  5. ZNT3 and ZNT8 (implicated in insulin secretion regulation) exhibit opposing effects on insulin synthesis and secretion, potentially through transcriptional co-regulation, as evidenced by the inverse correlation between their mRNA expression levels. ZNT3 overexpression reduced insulin synthesis and secretion. (PMID: 26867900)
  6. Reduced ZnT3 levels in the prefrontal cortex were associated with cognitive impairment in patients with dementia with Lewy bodies or Parkinson's disease dementia. (PMID: 25104558)
  7. Gender-specific association of SLC30A3 SNPs with schizophrenia was observed in an East UK cohort. (PMID: 23849395)
  8. Evidence suggests a role for zinc in depression among individuals with dementia. (PMID: 24953873)
  9. Decreased ZnT3 protein levels were found in the spinal cords of patients with sporadic amyotrophic lateral sclerosis (ALS). (PMID: 25284286)
  10. hZnT-3 is expressed at low levels in leukocytes. (PMID: 17971500)
  11. ZNT3 is widely present in amyloid-beta (Aβ)-positive plaques in the cortex of human Alzheimer's disease (AD) brains. (PMID: 18639746)
  12. Dityrosine bond-mediated oligomerization of SLC30A3 (ZnT3) regulates its subcellular localization and metal transport capacity. (PMID: 19521526)
Database Links

HGNC: 11014

OMIM: 602878

KEGG: hsa:7781

STRING: 9606.ENSP00000233535

UniGene: Hs.467981

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome. Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.

Q&A

What is the molecular structure of human ZnT-3?

Human ZnT-3 is a membrane protein with six transmembrane domains, with both N- and C-termini located in the cytoplasm. The protein shares 86% amino acid identity with murine ZnT-3. It has a relatively short cytoplasmic loop connecting transmembrane domains IV and V and lacks the characteristic histidines found in other zinc transporters like ZnT-1 and ZnT-2. The C-terminal tail (approximately 150 amino acids) shares significant similarity with ZnT-2 . When expressing recombinant human ZnT-3, researchers should consider that proper membrane insertion and folding are critical for structural integrity and functional assessment.

What is the primary function of ZnT-3 in the central nervous system?

The primary function of ZnT-3 is to facilitate zinc accumulation in synaptic vesicles, particularly in glutamatergic neurons . This vesicular zinc is co-released with glutamate during high-frequency stimulation and modulates various receptors, including ionotropic glutamate and γ-aminobutyric acid receptors . ZnT-3-mediated zinc sequestration enables zinc to function as a neuromodulator in synaptic transmission. The pattern of ZnT-3 protein expression closely matches the histochemical localization of vesicular zinc by Timm's staining, further supporting its role in vesicular zinc accumulation . Researchers working with recombinant ZnT-3 should assess transport activity through zinc uptake assays rather than relying solely on protein expression.

What is the tissue distribution pattern of ZnT-3 expression?

ZnT-3 expression is highly restricted compared to other zinc transporters. Northern blot and reverse transcriptase-PCR analyses demonstrate that murine ZnT-3 mRNA is primarily expressed in the brain and testis . Within the brain, in situ hybridization reveals that ZnT-3 mRNA is most abundant in the hippocampus and cerebral cortex . At the protein level, ZnT-3 is predominantly detected in the mossy fiber projections from granule cell neurons in the dentate gyrus, as well as in projections from hippocampal pyramidal cells and in the cortex .

Interestingly, while ZnT-3 mRNA is more abundant in adult testis than brain, the protein has not been detected in testis by Western blot or immunocytochemistry, suggesting post-transcriptional regulation in this tissue . This discrepancy indicates that translation efficiency should be considered when designing recombinant expression systems.

How does ZnT-3 distribution correlate with zinc localization in the brain?

ZnT-3 protein distribution strongly correlates with histochemically reactive zinc in synaptic vesicles. Antibody staining patterns of ZnT-3 are remarkably similar to Timm's staining, which detects loosely bound synaptic zinc . The most intense ZnT-3 immunostaining is observed in the mossy fiber projections from the dentate gyrus granule cells, matching regions with high zinc content . One notable exception is the dendritic field of dentate granule cells, which react with ZnT-3 antibodies but not with Timm's staining procedure . This close correlation supports ZnT-3's role as the primary transporter responsible for zinc accumulation in synaptic vesicles.

What are effective methods for detecting ZnT-3 in experimental systems?

For detecting ZnT-3 in experimental systems, researchers have successfully used:

  • Western blot analysis: A rabbit polyclonal antibody against the C-terminal cytoplasmic tail of mouse ZnT-3 can detect a specific band of approximately 40 kDa in brain samples and in transfected cells expressing ZnT-3 .

  • Immunohistochemistry: The same C-terminal antibody produces specific staining in brain sections, particularly intense in mossy fiber projections from dentate gyrus granule cells .

  • In situ hybridization: This technique reveals ZnT-3 mRNA localization, showing highest expression in hippocampus and cerebral cortex .

When developing detection methods for recombinant human ZnT-3, the C-terminal region appears to be a good antigenic target, but thorough validation of antibody specificity is essential, particularly distinguishing from other ZnT family members.

How can researchers visualize zinc accumulation in relation to ZnT-3 activity?

Several complementary approaches can visualize zinc accumulation related to ZnT-3 activity:

  • Timm's staining: This histochemical method reveals loosely bound synaptic zinc and produces a pattern very similar to ZnT-3 immunostaining in the brain .

  • Fluorescent zinc probes: Compounds such as TSQ and Zinquin can be used to visualize zinc in cells and tissues, though the search results note that ZnT-3 expression in BHK cells did not produce zinquin fluorescence when grown in zinc-supplemented medium .

  • Correlative imaging: Combining ZnT-3 immunofluorescence with zinc detection methods can demonstrate the relationship between ZnT-3 expression and zinc accumulation .

For recombinant systems, these visualization methods can be adapted to assess the functional activity of expressed ZnT-3 protein, though specialized conditions may be needed to detect transport activity.

What cell models are appropriate for studying recombinant human ZnT-3 function?

When selecting cell models for recombinant human ZnT-3 studies, consider:

  • Neuronal cell lines: Given ZnT-3's primarily neuronal expression, neuronal cell lines may provide a more physiologically relevant environment.

  • BHK cells: These have been used for expression of ZnT family proteins, though the search results indicate that ZnT-3 expression in BHK cells did not protect against zinc toxicity unlike ZnT-2 .

  • Models with vesicular compartments: Since ZnT-3 localizes to synaptic vesicles, cell models with well-developed vesicular compartments would be advantageous.

  • Protein complex considerations: ZnT-3 may function as part of a protein complex, as complementation experiments in BHK cells did not result in zinc resistance or accumulation . Cell models expressing potential interacting partners may be necessary for full functional studies.

  • Knockout models: Cells derived from ZnT-3 knockout animals could provide a clean background for complementation studies with human ZnT-3 .

How do SLC30A3 genetic variants affect glutamatergic neurotransmission?

SLC30A3 genetic variants demonstrate significant effects on glutamatergic neurotransmission, particularly in neuropsychiatric disorders:

  • In schizophrenia patients with at least one copy of minor alleles of two SLC30A3 SNPs (rs11126936 and rs11126929), there were reductions in dorsal anterior cingulate cortex glutamate during an n-back cognitive task, whereas patients without the minor allele showed an increase in glutamate .

  • In bipolar disorder patients with the minor allele, there was reduced glutamate in the anterior cingulate cortex .

  • These findings suggest that SLC30A3 variants influence glutamate dynamics during cognitive processing, potentially through altered zinc modulation of glutamate receptors .

The molecular mechanisms linking these genetic variants to altered glutamatergic function remain to be fully elucidated but may involve changes in ZnT-3 expression, localization, or transport activity, affecting the availability of zinc as a neuromodulator at glutamatergic synapses.

What is the relationship between ZnT-3 function and schizophrenia pathophysiology?

Evidence suggests several connections between ZnT-3 function and schizophrenia pathophysiology:

  • ZnT-3 has been implicated in the etiopathology of schizophrenia, suggesting a role in disease development or progression .

  • Variants in the SLC30A3 gene are associated with altered glutamate dynamics during cognitive tasks in schizophrenia patients .

  • Since vesicular zinc modulates ionotropic glutamate receptors and GABA receptors, alterations in ZnT-3 function could affect the balance of excitatory and inhibitory neurotransmission, which is often disrupted in schizophrenia .

  • The search results do not indicate effects of SLC30A3 genotype on BOLD activation during cognitive tasks or on cortical brain volume, suggesting that the influence may be primarily at the level of neurotransmitter dynamics rather than gross brain structure or function .

These findings highlight the potential value of studying recombinant human ZnT-3 as a target for understanding schizophrenia mechanisms, particularly related to glutamatergic dysfunction.

What imaging techniques are most informative for studying ZnT-3-related brain changes?

Several neuroimaging techniques have proven valuable for studying ZnT-3-related brain changes:

  • Proton Magnetic Resonance Spectroscopy (1H-MRS): This technique allows measurement of brain glutamate levels, which were shown to be affected by SLC30A3 variants in schizophrenia and bipolar disorder patients .

  • Functional Magnetic Resonance Spectroscopy (1H-fMRS): This dynamic application of MRS can detect changes in glutamate levels during cognitive tasks, as demonstrated in the study of SLC30A3 variants .

  • Functional Magnetic Resonance Imaging (fMRI): Although the search results did not show effects of SLC30A3 genotype on BOLD activation during the n-back task, fMRI remains valuable for assessing potential effects on brain activation patterns .

  • Structural MRI: This can assess potential effects on brain volume or morphology, though the search results did not indicate effects of SLC30A3 genotype on cortical brain volume .

These techniques should be complemented by genetic analysis of SLC30A3 variants to correlate imaging findings with genetic variation in studies of recombinant human ZnT-3 function.

What are the critical controls needed when studying recombinant ZnT-3?

When studying recombinant ZnT-3, implement these critical controls:

  • Expression verification: Western blotting and immunocytochemistry to confirm proper expression and localization. The search results describe a specific antibody against the C-terminal tail of ZnT-3 effective for this purpose .

  • Specificity controls: Expression of related transporters (e.g., ZnT-1, ZnT-2) to demonstrate specificity of observed effects. Antibodies against ZnT-3 did not cross-react with ZnT-1 or ZnT-2 .

  • Functional validation: Measurement of zinc transport activity, possibly using fluorescent zinc probes or radioactive 65Zn.

  • Subcellular localization: Confirmation that recombinant ZnT-3 localizes to appropriate vesicular compartments, potentially using markers of synaptic vesicles.

  • Mutant controls: Expression of non-functional mutants or variants to demonstrate that observed effects depend on ZnT-3 transport activity.

  • Zinc dependence: Demonstration that observed effects are zinc-dependent, using zinc chelators or varying extracellular zinc concentrations.

These controls ensure that observations attributed to recombinant ZnT-3 are specific to its function rather than artifacts of the expression system.

How can researchers differentiate between direct effects of ZnT-3 and secondary effects of altered zinc homeostasis?

Differentiating direct ZnT-3 effects from secondary zinc homeostasis effects requires:

  • Temporal analysis: Monitoring the time course of events following manipulation of ZnT-3 expression or activity to distinguish primary from secondary effects.

  • Subcellular specificity: Since ZnT-3 primarily affects vesicular zinc, effects specific to vesicular compartments are more likely direct consequences of ZnT-3 function.

  • Zinc supplementation experiments: If a phenotype can be rescued by zinc supplementation in ZnT-3-deficient systems, it suggests a direct link to ZnT-3-mediated zinc transport.

  • Comparison with other zinc transporters: Effects specific to ZnT-3 manipulation and not observed with other zinc transporters are more likely direct.

  • Single-cell analysis: Examining effects in individual cells expressing different levels of ZnT-3 can help establish dose-dependent relationships characteristic of direct effects.

What are the challenges in generating functional recombinant human ZnT-3 protein?

Generating functional recombinant human ZnT-3 presents several challenges:

  • Proper membrane insertion: As a six-transmembrane domain protein, ensuring proper folding and membrane insertion is critical .

  • Subcellular localization: In its native context, ZnT-3 localizes to synaptic vesicles, which may be difficult to recapitulate in heterologous expression systems .

  • Protein complex requirements: The search results suggest that ZnT-3 may function as part of a protein complex, as complementation experiments in BHK cells did not result in zinc resistance or accumulation .

  • Expression levels: Zinc transporters may be expressed at low levels and undergo rapid protein turnover, affecting recombinant expression .

  • Transport activity assessment: Unlike some other zinc transporters, ZnT-3 does not protect against zinc toxicity in BHK cells, making functional complementation assays challenging .

Overcoming these challenges may require optimization of expression constructs, careful selection of host cells, and development of specialized assays to detect ZnT-3 activity.

How should researchers interpret contradictory findings about ZnT-3 function across different experimental models?

To resolve contradictory findings about ZnT-3 function:

  • Standardize methodology: Develop consistent protocols for ZnT-3 expression, localization assessment, and functional analysis.

  • Cross-validate in multiple systems: Test hypotheses in different cell types, primary cultures, and in vivo models to identify context-dependent effects.

  • Consider protein complexes: ZnT-3 may function as part of a complex, and the presence or absence of interacting partners could explain discrepancies between models .

  • Examine genetic background effects: Control for or explicitly study the influence of genetic background on ZnT-3 function, particularly in relation to the SLC30A3 variants described in the search results .

  • Technical limitations: Critically evaluate whether contradictions arise from limitations in sensitivity or specificity of assays used to measure ZnT-3 function.

  • Direct replication studies: Directly test contradictory findings in side-by-side experiments with consistent methodology.

By applying these approaches, researchers can build a more coherent understanding of ZnT-3 function despite apparent contradictions.

How do ZnT-3 knockout models inform our understanding of zinc's role in neuropsychiatric disorders?

ZnT-3 knockout models provide valuable insights into zinc's role in neuropsychiatric disorders. The search results mention that "cloning of the mouse ZnT-3 gene provides an opportunity to inactivate it by homologous recombination" and that this "could provide definitive evidence regarding the role of this gene product in zinc sequestration" and an "opportunity to explore the function of this vesicular pool of zinc in neuronal function, learning, and memory" .

Such models can:

  • Demonstrate the specific contribution of vesicular zinc to synaptic function and plasticity

  • Reveal behavioral phenotypes relevant to neuropsychiatric disorders

  • Allow assessment of compensatory mechanisms in zinc homeostasis

  • Provide a platform for testing interventions targeting zinc signaling

  • Enable the study of interactions between genetic and environmental factors

When studying recombinant human ZnT-3, comparing its ability to rescue phenotypes in knockout models could provide insights into functional conservation and the effects of human variants .

What considerations should guide ZnT-3 targeting with genetic tools like CRISPR/Cas9?

When targeting ZnT-3 with CRISPR/Cas9, consider:

  • Target specificity: Design guide RNAs carefully to avoid off-target effects, particularly given the homology between ZnT-3 and other SLC30 family members .

  • Functional domains: Target critical functional domains based on structure-function knowledge. ZnT-3 has six transmembrane domains and a C-terminal tail that shares similarity with ZnT-2 .

  • Validation strategies: Use multiple guide RNAs and validate edits through sequencing, protein expression analysis, and functional assays specific to ZnT-3.

  • Cell type specificity: Consider using cell type-specific Cas9 expression systems to target ZnT-3 in relevant cell populations, such as hippocampal neurons where ZnT-3 is highly expressed .

  • Temporal control: Implement inducible CRISPR systems to control the timing of ZnT-3 editing, particularly important given potential developmental roles.

  • Phenotypic characterization: Develop comprehensive phenotyping strategies that include assessment of vesicular zinc levels, glutamatergic neurotransmission, and behavioral outcomes relevant to neuropsychiatric disorders .

These considerations ensure that genetic manipulation of ZnT-3 is specific, efficient, and informative for understanding its function in normal physiology and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.