Recombinant Human Zinc transporter 7 (SLC30A7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Zinc Transporter 7 (SLC30A7)

Recombinant Human Zinc Transporter 7, encoded by the gene SLC30A7, is a crucial protein involved in zinc homeostasis within cells. It is primarily localized to the early secretory pathway, specifically on the cis-face of the Golgi apparatus and cytoplasmic vesicles . This transporter plays a vital role in transporting zinc ions from the cytoplasm into the Golgi apparatus, which is essential for various cellular functions, including the activation of enzymes and insulin synthesis .

Structure and Function

SLC30A7, also known as ZnT7, functions as a zinc transporter that helps load zinc into the Golgi apparatus. Recent cryo-EM studies have revealed that human ZnT7 exists as a dimer with a unique histidine-rich loop that facilitates zinc binding and transport . This loop is crucial for recruiting zinc ions from the cytosol and transporting them into the Golgi lumen .

Key Features of SLC30A7:

  • Localization: Primarily found in the Golgi apparatus and cytoplasmic vesicles.

  • Function: Transports zinc ions into the Golgi apparatus.

  • Importance: Essential for enzyme activation and insulin synthesis.

Biological Significance

SLC30A7 is widely expressed in tissues such as the liver, small intestine, brain, spleen, kidney, and lung . Its disruption in mice leads to impaired growth, reduced zinc absorption, and decreased body adiposity, highlighting its role in zinc homeostasis and fat regulation . Additionally, SLC30A7 influences insulin synthesis and secretion by regulating insulin gene transcription .

Biological Roles of SLC30A7:

RoleDescription
Zinc TransportTransports zinc into the Golgi apparatus for enzyme activation.
Insulin RegulationInfluences insulin synthesis and secretion.
Fat RegulationPlays a role in body adiposity.

Research Findings

Recent studies have shown that SLC30A7 is involved in prostate cancer progression, with null mutations accelerating tumor formation in mice . In diabetes research, combined deletion of SLC30A7 and SLC30A8 (another zinc transporter) abolishes glucose-stimulated insulin secretion, indicating a compensatory role of SLC30A7 in pancreatic islet function .

Impact on Diseases:

  • Prostate Cancer: Insufficient SLC30A7 activity may contribute to cancer progression.

  • Diabetes: SLC30A7 compensates for SLC30A8 in insulin secretion.

Recombinant Protein Production

Recombinant SLC30A7 proteins are produced for research purposes, often expressed in systems like E. coli. For example, a recombinant full-length Xenopus laevis Zinc Transporter 7-A protein is available, which is His-tagged and expressed in E. coli .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SLC30A7; ZNT7; ZNTL2; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7; Znt-like transporter 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-376
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFN GALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTPPL LENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFT QAGVRQLYVQIDFAAM
Uniprot No.

Target Background

Function
SLC30A7, also known as Zinc transporter 7 (ZnT7), facilitates the transport of zinc from the cytoplasm into the Golgi apparatus. It plays a role in regulating cellular zinc homeostasis and is essential for activating zinc-requiring enzymes, such as alkaline phosphatases (ALPs), in conjunction with ZNT5. ZnT7 transports zinc into the lumens of the Golgi apparatus and vesicular compartments where ALPs reside, converting apoALPs to holoALPs. This process, along with ZNT5 and ZNT6, is crucial for activating tissue nonspecific alkaline phosphatase (TNAP).
Gene References Into Functions
  1. Our research indicated statistically significant interactions (after Bonferroni correction) between albuminuria, urine cadmium levels, and polymorphisms in the SLC30A7 and RAC1 genes. PMID: 28558300
  2. Overexpression of ZnT7 is associated with activation of the PI3K/Akt pathway and inhibition of apoptosis induced by high glucose levels. PMID: 23275032
  3. Intracellular transporters, such as ZnT7, influence the transcellular movement of zinc across enterocytes. PMID: 21462106
  4. hZnT-7 is upregulated in response to cellular zinc depletion in Raji and THP-1 cells. PMID: 17971500
  5. Studies have shown that ZNT7 is extensively present in Abeta-positive plaques in the cortex of human Alzheimer's disease brains. PMID: 18639746

Show More

Hide All

Database Links

HGNC: 19306

OMIM: 611149

KEGG: hsa:148867

STRING: 9606.ENSP00000350278

UniGene: Hs.533903

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of human ZnT7 (SLC30A7)?

Human ZnT7 exists as a homodimer with tight interactions in both the cytosolic and transmembrane (TM) domains. Each protomer contains a single Zn²⁺-binding site in its TM domain. High-resolution cryo-EM structures (2.2-3.1 Å) reveal that hZnT7 undergoes TM-helix rearrangements between outward-facing and inward-facing conformations to facilitate Zn²⁺ transport . The protein contains a unique, exceptionally long cytosolic histidine-rich loop that can bind at least two Zn²⁺ ions, which likely facilitates Zn²⁺ recruitment from the cytosol to the transport pathway .

The zinc-binding site (STM) in the transmembrane domain is surrounded by specific amino acid residues including:

  • Carboxyl groups of Asp74 (S2) and Asp244 (S5)

  • Imidazole rings of His70 (S2) and His240 (S5)

What is the primary function of SLC30A7 in cellular zinc homeostasis?

SLC30A7 functions as a zinc ion transporter that mediates zinc entry from the cytosol into the lumen of organelles along the secretory pathway . It primarily localizes to the Golgi membrane and operates as a Zn²⁺/H⁺ antiporter . By contributing to zinc ion homeostasis within the early secretory pathway, it regulates the activation and folding of enzymes such as alkaline phosphatases . The transporter undergoes conformational changes to create a negatively charged cytosolic cavity for Zn²⁺ entry in the inward-facing conformation and widens the luminal cavity for Zn²⁺ release in the outward-facing conformation .

How does SLC30A7 transport mechanism differ from other zinc transporters?

SLC30A7 is distinguished by its specific localization to the Golgi membrane and its unique structural features. Unlike plasma membrane transporters, SLC30A7 functions in intracellular zinc compartmentalization. A key distinctive feature is its exceptionally long cytosolic histidine-rich loop which serves to bind zinc ions and facilitate their recruitment to the transmembrane transport pathway .

The transport mechanism involves a conformational change between inward-facing and outward-facing forms, with the TM helices S4 and S5 repositioning to alter the zinc transport cavity dimensions - wider on the cytosolic side and narrower at the luminal side in the inward-facing form compared to the outward-facing form .

What antibodies are available for studying SLC30A7 expression and localization?

Several validated antibodies are available for SLC30A7 research applications. For example, the rabbit polyclonal ZnT-7 antibody (ab223065) has been validated for Western blot (WB) and immunohistochemistry on paraffin-embedded tissues (IHC-P) applications in both mouse and human samples . This antibody is raised against a recombinant fragment protein within Human SLC30A7 (amino acids 150-250) .

For Western blot applications, the recommended dilution is 1/1000, with a predicted band size of 42 kDa, which matches the observed band size in validated tissues . For IHC-P applications, a dilution of 1/100 has been validated in human placental tissue .

How can I establish a SLC30A7 knockout cellular model for functional studies?

CRISPR/Cas9 technology has been successfully employed to generate SLC30A7 knockout cell lines. Commercial knockout HeLa cell lines are available with knockout achieved through a 1 bp insertion in exon 1 and a 4 bp deletion in exon 1 . These genetic modifications create a frameshift that disrupts protein expression.

For researchers developing their own knockout models, targeting exon 1 has proven effective. The knockout protocol should include:

  • Design of guide RNAs targeting exon 1 of SLC30A7

  • Transfection of cells with CRISPR/Cas9 and guide RNA constructs

  • Selection and isolation of single-cell clones

  • Validation of knockout through genomic DNA sequencing to confirm mutations

  • Verification of protein absence through Western blot analysis

  • Functional validation through zinc transport assays

When designing functional studies, researchers should include appropriate wild-type controls alongside knockout cells to establish clear phenotypic differences .

What methods can be used to assess SLC30A7-mediated zinc transport activity?

Several approaches can be employed to study SLC30A7-mediated zinc transport:

  • Fluorescent zinc indicators: Fluorescent probes like FluoZin-3 can be used to measure changes in zinc concentration in different cellular compartments. By targeting these probes to the Golgi apparatus, researchers can directly measure SLC30A7-mediated zinc transport.

  • Radioactive zinc (⁶⁵Zn) transport assays: These assays measure the accumulation of radioactive zinc in various cellular compartments, allowing for quantitative assessment of transport activity.

  • Zinc-responsive enzyme activity: Since SLC30A7 regulates the activation of zinc-dependent enzymes like alkaline phosphatases, measuring their activity can serve as an indirect measure of SLC30A7 function .

  • Cryo-EM structural analysis: For advanced studies, cryo-EM analysis can be conducted with and without zinc to determine the conformational changes and zinc binding in the protein structure .

When conducting these assays, it's critical to include appropriate controls such as SLC30A7 knockout cells or cells treated with zinc transport inhibitors to establish specificity of the observed effects.

What is the role of SLC30A7 in Type 2 Diabetes (T2D)?

Genetic studies have revealed a significant association between SLC30A7 function and type 2 diabetes (T2D) risk. Remarkably, loss of SLC30A7 function has been shown to protect against T2D in humans . This protection is gene-dose dependent, with partial loss of function associated with a statistically significant improvement in glucose tolerance and insulin secretion.

Meta-analysis combining gene burden tests identified SLC30A7 as having the strongest protective effect against T2D among six genes reaching exome-wide significance (p = 5E-08, OR = 0.64 [0.54-0.75]) . Key findings from studies of SLC30A7 deficiency include:

  • Lower random blood glucose (β = −0.2 [-0.27, −0.13], p = 1.7E-11)

  • Lower HbA1c levels (β= −0.08 [-0.22, −0.006], p = 0.048)

  • Higher insulin levels (β = 0.46 [0.21, 0.71], p = 0.008)

  • Non-fasted insulin levels 5-fold higher in complete knockouts

  • Increase in C-peptide levels in knockouts (p recessive = 0.04)

  • Lower self-reported family history of diabetes (OR = 0.82 [0.68-0.98])

These findings suggest that SLC30A7 inhibition could represent a novel therapeutic approach for T2D prevention and treatment that operates independently of weight loss-based mechanisms.

How is SLC30A7 implicated in diabetic retinopathy?

Recent research has identified a regulatory relationship between miR-200c-3p and SLC30A7 in diabetic retinopathy (DR). The microRNA miR-200c-3p has been shown to negatively target SLC30A7 in high glucose-induced human retinal microvascular endothelial cells (HRMECs) .

Mechanistically, this regulation occurs through direct binding of miR-200c-3p to the 3'-UTR of SLC30A7, as confirmed by dual luciferase reporter assays. Western blot analysis demonstrated that miR-200c-3p overexpression inhibits SLC30A7 protein levels in high glucose-induced HRMECs .

This regulatory pathway appears to modulate pyroptosis in retinal cells, with miR-200c-3p knockdown mitigating high glucose-induced pyroptosis of HRMECs. These findings provide the first demonstration of miR-200c-3p expression and function in DR and suggest potential therapeutic targets for treating this diabetic complication .

What is the relationship between SLC30A7 and cuproptosis in glioblastoma multiforme (GBM)?

Recent investigations have explored the role of SLC30A7 as a cuproptosis regulator in glioblastoma multiforme (GBM). Cuproptosis is a novel copper-dependent controlled cell death mechanism distinct from other known cell death pathways .

Research has identified three distinct cuproptosis regulation patterns in GBMs:

  • Immune activation pattern

  • Metabolic activation pattern

  • Immunometabolic double deletion pattern

A PPI (protein-protein interaction) network analysis was used to predict core-associated genes of cuproptosis regulators, with SLC30A7 identified as one of these novel regulators. Both in vitro and in vivo experiments were conducted to examine the function of SLC30A7 in this context .

The cuproptosis regulation patterns were shown to predict multiple tumor characteristics including:

  • Tumor inflammation

  • Molecular subtype

  • Stromal activity

  • Gene variation

  • Signaling pathway activation

  • Patient prognosis

This research suggests potentially significant roles for SLC30A7 in cancer biology beyond its established functions in zinc transport.

How can cryo-EM structural data be leveraged to develop SLC30A7 modulators?

The high-resolution cryo-EM structures (2.2-3.1 Å) of hZnT7 in both zinc-bound and unbound forms provide valuable insights for structure-based drug design approaches . Researchers can leverage these structural details to develop modulators of SLC30A7 activity through the following approaches:

  • Structure-based virtual screening: Using the atomic coordinates of the zinc-binding site (STM) in the TM domain to screen virtual compound libraries for potential binders that might inhibit or enhance zinc transport.

  • Rational design of binding site modulators: Targeting the key residues involved in zinc coordination (Asp74, Asp244, His70, and His240) with small molecules that can alter the conformation of these residues and affect zinc binding affinity .

  • Allosteric modulator development: Identifying potential allosteric sites, particularly at the interface between the two protomers of the SLC30A7 dimer, that could be targeted to modulate the conformational changes required for transport.

  • Histidine-rich loop targeting: Developing compounds that interact with the unique histidine-rich loop to alter its zinc-binding capacity or conformation, thereby affecting zinc recruitment to the transport pathway .

The structural data revealing the conformational changes between inward-facing and outward-facing forms provides particularly valuable insights for designing compounds that could stabilize one conformation over the other, thereby modulating transport function.

What are the implications of complete SLC30A7 loss of function in humans?

Studies of human SLC30A7 knockout individuals have provided groundbreaking insights into the physiological consequences of complete loss of function. These natural "human knockouts" include both males and females ranging in age from 43-75 years, many with children and grandchildren, indicating that complete SLC30A7 loss of function is not only compatible with life but generally well-tolerated .

Key findings from studies of these individuals include:

  • Complete loss of SLC30A7 function improves glucose metabolism but is not completely protective against T2D.

  • SLC30A7 loss of function does not impact BMI, suggesting its effects on glucose metabolism are independent of weight.

  • The significant improvements in glucose tolerance and insulin secretion occur without obvious detrimental effects in other physiological systems.

These observations strongly support the safety of therapeutic approaches targeting SLC30A7 for T2D treatment and provide valuable insights for risk assessment of potential side effects. The identification and study of these natural knockouts represent a powerful approach for validating potential drug targets in humans .

How can SLC30A7 function be modulated by miRNA-based approaches?

The discovery that miR-200c-3p negatively regulates SLC30A7 expression in high glucose conditions opens avenues for miRNA-based therapeutic approaches . Researchers interested in exploring this direction should consider:

  • miRNA delivery strategies: Development of tissue-specific delivery systems for miR-200c-3p mimics or inhibitors, depending on the desired effect on SLC30A7 expression.

  • Target specificity analysis: Comprehensive bioinformatic analysis to identify all potential targets of miR-200c-3p beyond SLC30A7, to predict potential off-target effects.

  • Conditional regulation systems: Design of inducible miRNA expression systems that allow for temporal control of SLC30A7 modulation.

The binding site of miR-200c-3p in the 3'-UTR of SLC30A7 has been identified, enabling the development of specific approaches that target this interaction . This knowledge could be leveraged to design modified miRNAs with enhanced specificity for SLC30A7 or to develop small molecules that either block or enhance this miRNA-mRNA interaction.

When employing miRNA-based approaches, researchers should include appropriate controls and validation experiments, including:

  • qRT-PCR to confirm changes in miR-200c-3p levels

  • Western blot analysis to verify SLC30A7 protein expression changes

  • Functional assays to assess the impact on zinc transport

  • Phenotypic assays relevant to the disease context being studied

What are best practices for expressing and purifying recombinant SLC30A7 for structural and functional studies?

Obtaining high-quality recombinant SLC30A7 protein is crucial for structural and functional studies. Based on successful approaches used for cryo-EM studies, the following protocol is recommended:

  • Expression system selection: Mammalian expression systems (particularly HEK293 cells) are preferred over bacterial systems to ensure proper folding and post-translational modifications.

  • Construct design:

    • Include a cleavable affinity tag (His-tag or FLAG-tag) for purification

    • Consider removing the histidine-rich loop (ΔHis-loop) for some structural studies, as this flexible region can complicate structural analysis

    • Retain both N- and C-terminal domains to maintain proper protein folding

  • Solubilization and purification:

    • Use mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) for initial solubilization

    • Consider nanodisc or amphipol reconstitution for functional studies

    • Implement size-exclusion chromatography as a final purification step to ensure homogeneity

  • Quality control assessments:

    • Verify protein purity by SDS-PAGE and Western blotting

    • Confirm proper folding through circular dichroism spectroscopy

    • Validate functionality through zinc binding assays

  • Storage conditions:

    • Store purified protein at -80°C in buffer containing 10% glycerol

    • Avoid repeated freeze-thaw cycles

    • Include zinc chelators only when studying the unbound form

For researchers specifically interested in structural studies, additional considerations include buffer optimization to maintain protein stability during sample preparation for techniques such as cryo-EM.

How can I design experiments to investigate the role of the histidine-rich loop in SLC30A7 function?

The unique histidine-rich loop of SLC30A7 represents an intriguing structural feature with functional significance. To investigate its role, consider the following experimental approaches:

  • Structure-function analysis through mutagenesis:

    • Generate loop deletion mutants (ΔHis-loop) as was done in cryo-EM studies

    • Create point mutations of specific histidine residues within the loop

    • Develop truncation series to identify critical regions of the loop

  • Zinc binding assessment:

    • Employ isothermal titration calorimetry (ITC) to quantify zinc binding parameters of wild-type versus mutant proteins

    • Use zinc-responsive fluorescent probes to monitor binding in cellular contexts

    • Apply NMR spectroscopy to map zinc interactions with specific histidine residues

  • Conformational dynamics studies:

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess conformational changes upon zinc binding

    • Utilize single-molecule FRET to monitor distance changes between strategic positions during transport cycle

    • Apply molecular dynamics simulations to predict loop behavior and interactions

  • Functional transport assays:

    • Compare zinc transport rates between wild-type and loop-modified variants

    • Assess the impact of loop modifications on transport kinetics and efficiency

    • Evaluate effects on conformational switching between inward-facing and outward-facing states

How might artificial intelligence approaches enhance our understanding of SLC30A7 structure-function relationships?

Artificial intelligence, particularly deep learning approaches, offers powerful new tools for SLC30A7 research:

  • Structure prediction refinement:

    • AlphaFold2 has already been applied to predict the structure of regions not visualized in cryo-EM studies, such as the histidine-rich loop

    • These predictions can guide experimental design by identifying potential functional motifs or interaction surfaces

  • Conformational dynamics modeling:

    • Machine learning approaches can help predict the complete conformational landscape between experimentally determined inward-facing and outward-facing states

    • These predictions can identify potential intermediate states and energy barriers in the transport cycle

  • Virtual screening and drug design:

    • AI-driven virtual screening can identify potential small molecule modulators of SLC30A7 activity

    • Deep learning models can optimize lead compounds for specificity and efficacy

  • Multi-omics data integration:

    • Machine learning can integrate transcriptomic, proteomic, and metabolomic data to reveal context-dependent regulation of SLC30A7

    • Network analysis approaches can identify key interaction partners and regulatory relationships

  • Predictive phenotyping:

    • AI models can predict the impact of SLC30A7 variants on phenotype, potentially identifying new disease associations

    • These predictions can guide the prioritization of variants for functional validation

Researchers should approach AI-generated predictions as hypotheses requiring experimental validation but can leverage these tools to significantly accelerate discovery and optimization processes in SLC30A7 research.

What is the potential therapeutic significance of targeting SLC30A7 for metabolic diseases?

The identification of SLC30A7 loss of function as protective against type 2 diabetes positions it as a promising therapeutic target. Several considerations are important for researchers exploring this potential:

  • Therapeutic modality selection:

    • Small molecule inhibitors targeting the zinc binding site or transport mechanism

    • Antisense oligonucleotides to reduce expression

    • Gene editing approaches for permanent modification

    • miRNA-based regulation through miR-200c-3p or other regulatory miRNAs

  • Target tissue considerations:

    • Pancreatic β-cells: SLC30A7 inhibition may enhance insulin secretion

    • Liver: Effects on hepatic glucose production

    • Skeletal muscle: Impact on glucose uptake and utilization

    • Adipose tissue: Potential effects on insulin sensitivity

  • Safety assessment framework:

    • Natural human knockouts provide valuable safety data, showing complete loss is well-tolerated

    • Tissue-specific conditional knockout models can identify potential tissue-specific adverse effects

    • Dose-response studies to determine threshold effects

  • Combination therapy potential:

    • Synergies with existing diabetes medications

    • Effects on other metabolic parameters beyond glucose control

    • Impact on diabetes complications (e.g., retinopathy)

  • Biomarker development:

    • Zinc status as a potential biomarker for treatment response

    • Activity of zinc-dependent enzymes as pharmacodynamic markers

    • Glucose metabolism parameters as efficacy indicators

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.