Recombinant Human Zinc transporter ZIP11 (SLC39A11)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant Human ZIP11 is produced using heterologous expression systems (e.g., E. coli or wheat germ) and engineered with affinity tags (e.g., His-GST) for purification and detection. Key features include:

PropertySpecification
UniProt IDQ8N1S5
Protein LengthPartial (e.g., 93–193 aa fragment) or full-length
Molecular Weight~42 kDa (partial)
Purity>90% (SDS-PAGE verified)
Expression SystemE. coli or wheat germ extract
TagN-terminal 6xHis-GST
StorageLiquid (Tris/PBS buffer with glycerol) or lyophilized powder (6% trehalose, pH 8.0)
Key ApplicationsIn vitro zinc transport assays, immunoblotting, functional studies in cancer models

Source:

Functional Insights

ZIP11 is a nuclear zinc transporter critical for maintaining subcellular zinc homeostasis. Key functional attributes include:

  • Subcellular Localization: Primarily localized to the nucleus, Golgi apparatus, and plasma membrane in HeLa cells .

  • Transport Mechanism: Mobilizes zinc from the nucleus and Golgi to the cytosol, preventing nuclear zinc overload .

  • Metal Specificity: Predominantly transports zinc but may also interact with copper ions .

Table 1: Functional Domains of ZIP11

DomainRoleKey Residues
Transmembrane (TM)Forms a zinc-permeable channelH204, E208, E244 (metal-binding sites)
Histidine-rich loopFacilitates zinc coordination and transportMultiple His residues
N-terminal GST tagEnhances solubility and purificationEngineered tag

Cancer Biology

  • Proliferation & Metastasis: ZIP11 knockdown (KD) in HeLa cells reduces proliferation, migration, and invasion by disrupting nuclear zinc homeostasis .

  • Gene Expression: KD dysregulates pathways like Notch signaling and cell cycle genes (e.g., CDK20), inducing senescence .

  • Cancer Prognosis: Low ZIP11 expression correlates with higher glioma grades and bladder cancer risk .

Longevity & Aging

  • GWAS Studies: SNPs in SLC39A11 are linked to male longevity in Chinese centenarians .

  • Animal Models: Slc39a11 mutant zebrafish and mice exhibit dysregulated manganese (Mn) and iron (Fe) levels, suggesting pleiotropic roles in metal homeostasis .

Zinc Homeostasis

  • ZIP11 KD in HeLa cells increases nuclear zinc by 2-fold, impairing mitochondrial potential and activating MTF1/MT1 stress responses .

  • Overexpression of ZIP11 mutants (e.g., A89V, H204A) fails to rescue nuclear zinc accumulation, confirming their role in transport .

Mutational Analysis

  • SNPs: Coding SNPs (e.g., A26S, A234P) restore zinc transport in KD cells, while metal-binding site (MBS) mutations (e.g., E208A) mimic KD phenotypes .

  • Pathogenic Variants: Mutations in ZIP11’s MBS disrupt zinc efflux, enhancing cancer cell sensitivity to extracellular zinc .

Table 2: Functional Impact of ZIP11 Mutations

MutationNuclear Zn LevelsProliferationPhenotype
Wild-typeNormalNormalBaseline zinc transport
A89VHighImpairedSenescence, cell cycle arrest
H204AHighImpairedLoss of metal-binding capacity

Source:

Pathological Implications

  • Cancer: ZIP11 supports tumor progression by maintaining nuclear zinc levels required for DNA repair and metastatic signaling .

  • Neurodegeneration: Dysregulated zinc transport by ZIP11 may contribute to diseases like Brown-Vialetto-Van Laere syndrome .

  • Therapeutic Potential: Targeting ZIP11 could sensitize cancer cells to zinc toxicity or chemotherapy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
SLC39A11; C17orf26; ZIP11; Zinc transporter ZIP11; Solute carrier family 39 member 11; Zrt- and Irt-like protein 11; ZIP-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC39A11
Target Protein Sequence
MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLL APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTL MKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSR GNLAQPGGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIGIGIQ NFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAG AMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
Uniprot No.

Target Background

Function
Functions as a cellular zinc transporter.
Gene References Into Functions
  1. Polymorphisms within the ZIP11 gene have been significantly associated with bladder cancer risk. PMID: 25900876
  2. In glioma tumors, low ZIP11 expression has been significantly associated with higher grade. Higher ZIP11 expression was weakly correlated with IDH1 mutation status. PMID: 25921144
  3. This research article details the genomic region surrounding the SOX9 gene, which encompasses SLC39A11 (C17orf26). PMID: 11707075
Database Links

HGNC: 14463

OMIM: 616508

KEGG: hsa:201266

STRING: 9606.ENSP00000445829

UniGene: Hs.221127

Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Golgi apparatus.

Q&A

What is ZIP11/SLC39A11 and what is its cellular localization?

ZIP11 (SLC39A11) is a member of the solute carrier family 39, which primarily functions as metal ion transporters. Unlike other ZIP family members that localize to the plasma membrane or organelle membranes, ZIP11 has been identified as the only ZIP transporter that localizes predominantly to the nucleus of mammalian cells. Analyses from stomach and colon tissues isolated from mouse models first suggested this unique nuclear localization . The protein is classified as a member of the GufA subfamily of ZIP proteins, with structural analyses suggesting it shares the characteristic features of the ZIP family, including eight transmembrane helices that form a tight bundle . When expressed in cellular models, epitope-tagged constructs demonstrate nuclear accumulation, distinguishing ZIP11 from other family members that primarily regulate cytoplasmic or organellar zinc levels .

Interestingly, while ZIP11 expression may not be highly responsive to zinc, evidence suggests a relationship between manganese levels and SLC39A11 expression. Experimental data indicates that SLC39A11 expression is sensitive to changes in Mn²⁺ levels, with a regulatory feedback mechanism potentially existing between manganese status and transporter expression .

What experimental models have been established for studying ZIP11/SLC39A11 function?

Several experimental models have been developed to investigate ZIP11/SLC39A11 function:

  • Cell line models:

    • HeLa cell lines with stable ZIP11 knockdown, showing reduced proliferation and nuclear zinc accumulation

    • Raw264.7 cells with ZIP11 knockdown demonstrating decreased cellular zinc levels

    • MDCK cells expressing mZip11-Flag constructs for localization and transport studies

  • Zebrafish models:

    • CRISPR/Cas9-generated slc39a11 mutant zebrafish with >90% reduction in mRNA levels

    • These models show developmental normality but reduced survival rates beginning at 8 months, with males showing greater susceptibility than females

    • Physical characteristics include less refractive epidermis and altered fin structures by 12 months

  • Mouse models:

    • Slc39a11 knockout (Slc39a11^(-/-)) mice that develop normally without abnormal neurobehavioral properties

    • These models exhibit significantly higher manganese concentrations in serum and various tissues at 2, 12, and 20 months of age

These diverse experimental systems allow for comprehensive investigation of ZIP11/SLC39A11 function across different biological contexts, from cellular to whole-organism levels.

How does ZIP11 knockdown affect nuclear zinc homeostasis and cellular function?

ZIP11 knockdown in HeLa cells results in significant dysregulation of nuclear zinc homeostasis, with several downstream consequences:

  • Zinc accumulation: ZIP11 KD causes nuclear accumulation of zinc, suggesting ZIP11 normally functions to export zinc from the nucleus .

  • Transcriptional changes: RNA-seq analyses revealed extensive gene expression changes in ZIP11 KD cells, particularly affecting:

    • Angiogenesis-related genes

    • Apoptotic pathways

    • mRNA metabolism

    • Various signaling pathways

  • Compensatory responses: Despite activation of metal homeostasis responses through MTF1 and metallothionein (MT1), ZIP11 KD cells show limited induction of other zinc transporters—only ZIP14 (a plasma membrane and endocytic vesicle importer) is mildly induced .

  • Cellular phenotypes:

    • Impaired migration and invasive properties

    • Decreased mitochondrial potential

    • Delayed cell cycle progression

    • Enhanced cellular senescence

These findings collectively suggest that maintenance of nuclear zinc homeostasis by ZIP11 is essential for normal cellular functions and particularly important for cancer progression, as the observed impairments in migration, invasion, and cell cycle indicate a potential tumor-suppressive effect of ZIP11 inhibition .

What are the implications of ZIP11/SLC39A11's role in metal transport for age-related research?

Recent research has established a novel role for SLC39A11 in longevity and age-related processes:

  • Survival impact: SLC39A11 knockout in zebrafish resulted in significantly lower survival rates beginning at 8 months of age, with a sexually dimorphic effect showing greater vulnerability in males .

  • Manganese homeostasis and aging: The consistent elevation of manganese in SLC39A11 knockout models suggests a mechanistic link between manganese dysregulation and accelerated aging. This is particularly relevant as oxidative stress serves as a mechanism common to both aging and manganese toxicity .

  • Tissue-specific effects: Age-dependent accumulation of manganese was observed in various tissues in SLC39A11 knockout mice, with different tissues showing varying degrees of manganese elevation at 2, 12, and 20 months of age .

  • Physical manifestations: Aging SLC39A11-deficient zebrafish display altered physical characteristics, including less refractive epidermis and modified fin structures by approximately 12 months of age, potentially modeling certain aspects of accelerated aging .

These findings position SLC39A11 as a longevity-associated protein and suggest that manganese homeostasis may be a previously underappreciated factor in aging processes. Researchers investigating aging mechanisms should consider SLC39A11-mediated metal transport as a potential target for interventions aimed at extending lifespan or healthspan.

What experimental design considerations are important when studying metal transporters like ZIP11/SLC39A11?

When designing experiments to investigate metal transporters like ZIP11/SLC39A11, several key considerations should be incorporated:

  • Metal specificity determination:

    • Implement inductively coupled plasma mass spectrometry (ICP-MS) to quantify multiple metals simultaneously in biological samples

    • Include measurements of potentially competing metals (Zn, Mn, Fe, Cu) to identify transporter specificity

    • Control for environmental metal exposure in experimental animals

  • Cellular localization assessment:

    • Employ subcellular fractionation combined with metal quantification

    • Use fluorescent metal probes with co-localization studies

    • Consider electron microscopy with metal detection techniques for highest resolution

  • Genetic model development:

    • Create both knockdown (transient) and knockout (permanent) models

    • Consider conditional knockout systems to study tissue-specific effects

    • Include appropriate controls for genetic compensatory mechanisms

  • Experimental design robustness:

    • For computer-aided experimental design, consider specialized design approaches such as latin hypercube designs through the lhs package, which are particularly useful when many different levels of factors need to be examined

    • Implement space-filling designs that ensure each experimental run provides additional information even when certain factors prove irrelevant

    • Use quality assessment measures from packages like DiceDesign to evaluate design quality for multifactorial experiments

  • Sex and age considerations:

    • Account for sex-specific differences, as demonstrated by the differential survival rates in male versus female SLC39A11-deficient zebrafish

    • Include appropriate age ranges to capture developmental and aging effects

    • Design longitudinal studies to monitor progressive changes, particularly for age-related phenotypes

By incorporating these design elements, researchers can develop more robust experimental protocols that accurately capture the complex biology of metal transporters like ZIP11/SLC39A11.

How can researchers effectively quantify ZIP11/SLC39A11-mediated metal transport in different cellular compartments?

Quantifying ZIP11/SLC39A11-mediated metal transport, particularly in the nucleus, requires specialized approaches:

  • Nuclear isolation and metal quantification:

    • Implement subcellular fractionation protocols optimized for nuclear isolation

    • Apply ICP-MS to quantify metal content in isolated nuclei with high sensitivity

    • Include appropriate controls to account for contamination from other cellular compartments

  • Live-cell imaging approaches:

    • Utilize fluorescent metal-specific probes with targeted localization to the nucleus

    • Implement FRET-based sensors for real-time monitoring of metal flux

    • Combine with fluorescently-tagged ZIP11 to correlate transporter location with metal movement

  • Genetically-encoded sensors:

    • Express metal-responsive fluorescent proteins in specific cellular compartments

    • Calibrate sensors against known metal concentrations

    • Monitor dynamic changes in response to ZIP11/SLC39A11 manipulation

  • Radioisotope transport assays:

    • Use radioactive zinc (⁶⁵Zn) or manganese (⁵⁴Mn) to directly measure transport kinetics

    • Implement pulse-chase experiments to determine transport rates

    • Combine with subcellular fractionation for compartment-specific analysis

  • Advanced analytical techniques:

    • Consider synchrotron radiation X-ray fluorescence microscopy for high-resolution metal mapping

    • Implement laser ablation ICP-MS for spatial resolution of metals in fixed specimens

    • Apply secondary ion mass spectrometry (SIMS) for subcellular metal localization

These methodologies provide complementary approaches to comprehensively characterize ZIP11/SLC39A11-mediated metal transport, allowing researchers to build a complete understanding of this transporter's role in cellular metal homeostasis.

What is the role of ZIP11/SLC39A11 in cancer progression and how might it be targeted for therapy?

ZIP11/SLC39A11 appears to have significant implications for cancer progression based on several lines of evidence:

  • Clinical correlations:

    • Elevated expression of ZIP11 has been correlated with poor prognosis in cervical cancer patients

    • Pan-cancer analysis of SLC39 family genes, including SLC39A11, suggests altered expression across multiple cancer types

  • Cellular mechanisms:

    • ZIP11 knockdown in HeLa cells significantly reduces cell proliferation

    • ZIP11-deficient cells show impaired migration and invasive properties

    • Nuclear zinc accumulation in ZIP11 KD cells triggers a senescent cellular state

    • Cell cycle progression is delayed in ZIP11-deficient cancer cells

  • Molecular pathways affected:

    • RNA-seq analyses reveal that ZIP11 knockdown disrupts genes involved in:

      • Angiogenesis

      • Apoptosis regulation

      • mRNA metabolism

      • Various signaling pathways critical for cancer progression

  • Potential therapeutic approaches:

    • Small molecule inhibitors targeting ZIP11 transport function

    • Gene silencing approaches to reduce ZIP11 expression

    • Induction of synthetic lethality by combining ZIP11 inhibition with other treatments

    • Exploitation of the enhanced sensitivity to elevated extracellular zinc levels in ZIP11-deficient cells

Given that ZIP11 knockdown led to nuclear zinc accumulation and subsequently reduced cancer cell proliferation and invasiveness, targeted inhibition of ZIP11 represents a promising avenue for anti-cancer drug development. The findings suggest that disruption of nuclear zinc homeostasis through ZIP11 inhibition may impair the machinery associated with DNA repair and maintain cancer cells in a less aggressive, senescent state .

How does the structure of ZIP11/SLC39A11 relate to its function, and what insights can be derived from structural homology?

While the specific structure of human ZIP11/SLC39A11 has not been fully elucidated, insights can be gained from structural studies of related ZIP transporters:

  • General ZIP transporter architecture:

    • ZIP transporters typically contain eight transmembrane (TM) helices that form a tight bundle

    • Both amino- and carboxy-termini face the extracellular domain

    • Functional transporters are proposed to form homodimers

  • Structural insights from bacterial ZIP homologs:

    • The structure of a bacterial ZIP (BbZIP) reveals an unusual 3+2+3TM structure

    • TM2, TM4, TM5, and TM7 constitute an inner bundle surrounded by the remaining TMs

    • TM2 contains a 36 amino acid-long domain with a kink associated with a conserved proline (P110)

    • TM4 and TM5 are bent due to the presence of two proline residues in metal-binding sites

  • Symmetry and metal binding:

    • BbZIP shows a novel symmetric structure with the first three TMs symmetrically related to the last three

    • Crystallization in the presence of CdCl₂ allowed identification of four Cd²⁺-binding sites

    • This structural arrangement supports previous hydrophobicity plot predictions for ZIP transporters

  • Structure-function relationships for ZIP11:

    • While no ZIP11-specific structural data is available, its classification in the GufA subfamily suggests structural features that may differ from other ZIP subfamilies

    • The nuclear localization of ZIP11 implies unique structural elements that direct it to this compartment

    • The ability to transport both zinc and manganese suggests metal coordination sites with flexibility in accommodating different ionic radii and coordination geometries

Understanding these structural features could inform the design of selective inhibitors targeting ZIP11 while sparing other ZIP family members, potentially leading to more precise therapeutic interventions for cancer and other conditions where ZIP11 dysregulation plays a role.

What are the recommended approaches for generating recombinant human ZIP11/SLC39A11 for experimental studies?

Producing recombinant human ZIP11/SLC39A11 presents specific challenges as a multi-pass membrane protein. Based on successful approaches with related transporters, the following methodologies are recommended:

  • Expression system selection:

    • Mammalian systems: HEK293 or CHO cells generally provide native-like post-translational modifications and folding machinery

    • Insect cell systems: Sf9 or High Five cells offer high yield with eukaryotic processing

    • Yeast systems: Pichia pastoris can produce larger quantities but may have different glycosylation patterns

    • Cell-free systems: Consider for rapid screening of constructs and mutations

  • Construct optimization:

    • Include epitope tags (FLAG, His, etc.) for detection and purification

    • Consider fusion proteins to enhance solubility (e.g., MBP, SUMO)

    • Optimize codon usage for the selected expression system

    • Include TEV or similar protease sites for tag removal if needed

  • Solubilization and purification:

    • Screen detergents systematically (DDM, LMNG, etc.)

    • Consider native nanodiscs or amphipols for maintaining function

    • Implement two-step purification (e.g., affinity followed by size exclusion)

    • Verify protein quality by SDS-PAGE, Western blot, and mass spectrometry

  • Functional validation:

    • Develop metal uptake assays using radioactive isotopes or fluorescent probes

    • Verify proper folding through circular dichroism

    • Confirm subcellular localization in mammalian cell transfection models

    • Validate transport kinetics against known parameters from cellular studies

  • Storage considerations:

    • Determine optimal buffer conditions for stability

    • Test cryoprotectants if freezing is necessary

    • Validate function after storage to ensure retention of activity

Researchers should note that murine Zip11 has been successfully expressed as a FLAG-tagged construct in previous studies, providing a foundation for human ZIP11 expression strategies .

How can researchers design effective knockdown and knockout strategies for ZIP11/SLC39A11 studies?

Designing effective genetic manipulation strategies for ZIP11/SLC39A11 requires careful consideration of several factors:

  • siRNA/shRNA approaches:

    • Design multiple siRNA sequences targeting different regions of the transcript

    • Validate knockdown efficiency via RT-qPCR (>90% reduction was achieved in zebrafish models)

    • Use inducible shRNA systems for temporal control of knockdown

    • Include scrambled sequences as controls

  • CRISPR/Cas9 knockout strategies:

    • Design guide RNAs targeting early exons to maximize disruption

    • Screen for frame-shifting mutations (the zebrafish model used a 2-bp insertion causing a frame shift)

    • Consider multiple guide RNAs to increase efficiency

    • Verify knockout at both mRNA and protein levels

  • Model-specific considerations:

    • Cell lines: Use antibiotic selection to generate stable lines

    • Zebrafish: CRISPR/Cas9 has been successfully used to generate germline mutations

    • Mice: Conventional knockout strategies have generated viable Slc39a11^(-/-) animals

  • Validation approaches:

    • RT-qPCR to confirm reduction in mRNA levels

    • Western blot to verify protein depletion

    • Functional assays to confirm physiological impact

    • Rescue experiments with wild-type constructs to confirm specificity

  • Phenotypic analysis timelines:

    • Consider both acute and long-term effects (zebrafish showed phenotypes at ~12 months)

    • Include age-matched controls

    • Monitor sex-specific differences in phenotype development

The successful generation of both zebrafish and mouse knockout models demonstrates the feasibility of these approaches, though researchers should anticipate potential compensatory mechanisms, particularly in developmental contexts.

What analytical methods are most appropriate for quantifying metal content in ZIP11/SLC39A11 research?

Accurate metal quantification is crucial for ZIP11/SLC39A11 research. Several analytical approaches have proven effective:

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS):

    • Provides highly sensitive multi-element detection

    • Successfully applied in both zebrafish and mouse SLC39A11 studies

    • Can detect differences in Mn, Zn, and Fe levels simultaneously

    • Requires careful sample preparation to minimize contamination

  • Atomic Absorption Spectroscopy (AAS):

    • Alternative method for metal quantification

    • Lower throughput but often more accessible than ICP-MS

    • Suitable for targeted analysis of specific metals

  • X-ray Fluorescence Microscopy:

    • Enables spatial mapping of metals within tissues or cells

    • Can provide insights into subcellular distribution

    • Particularly valuable for nuclear localization studies of ZIP11

  • Fluorescent Metal Probes:

    • Zinc-specific probes (FluoZin-3, Zinpyr-1) for live-cell imaging

    • Manganese-responsive sensors for tracking Mn2+ dynamics

    • Can be combined with fluorescently-tagged ZIP11 for co-localization studies

  • Sample preparation considerations:

    • Acid digestion protocols for tissue samples

    • Metal-free reagents and labware to prevent contamination

    • Appropriate certified reference materials for calibration

    • Matched matrix controls to account for biological matrix effects

  • Data analysis approaches:

    • Normalization to sample weight, protein content, or cell number

    • Statistical approaches appropriate for multiple metal comparisons

    • Correlation analyses between metals and phenotypic outcomes

When implementing these methods, researchers should be aware that SLC39A11 knockout has shown significant effects on manganese levels across multiple tissues and developmental timepoints, with more variable effects on zinc depending on the model system and age .

How can researchers accurately assess the impact of ZIP11/SLC39A11 on gene expression and cellular pathways?

To comprehensively evaluate ZIP11/SLC39A11's impact on gene expression and cellular pathways, researchers should consider:

  • Transcriptomic analysis approaches:

    • RNA-seq has successfully identified gene expression changes in ZIP11 knockdown HeLa cells

    • Consider time-course experiments to capture dynamic responses

    • Include appropriate replicates for statistical power

    • Validate key findings with RT-qPCR

  • Pathway analysis tools:

    • Gene Ontology (GO) enrichment analysis

    • Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway mapping

    • Gene Set Enrichment Analysis (GSEA)

    • Ingenuity Pathway Analysis (IPA) or similar commercial tools

  • Validation of pathway alterations:

    • Western blotting for key pathway proteins

    • Phospho-specific antibodies for signaling pathway activation

    • Reporter assays for transcription factor activity

    • Functional assays corresponding to identified pathways

  • Integration with metal homeostasis:

    • Correlate gene expression changes with metal level alterations

    • Focus on metal-responsive transcription factors (e.g., MTF1)

    • Analyze metallothionein expression as indicators of metal stress

    • Examine expression of other metal transporters for compensatory responses

  • Cellular phenotype correlation:

    • Link gene expression changes to observed phenotypes

    • Design rescue experiments targeting specific pathways

    • Consider pharmacological pathway inhibitors to confirm causality

    • Implement time-resolved analyses to establish sequence of events

Previous research has revealed that ZIP11 knockdown affects genes related to angiogenesis, apoptosis, mRNA metabolism, and various signaling pathways, with only limited compensatory responses through other zinc transporters . This suggests ZIP11 has unique functions that cannot be fully compensated by other family members.

What is the potential significance of ZIP11/SLC39A11 in human diseases beyond cancer?

While ZIP11/SLC39A11 has been primarily studied in cancer contexts, emerging evidence suggests broader implications for human health:

  • Aging and longevity:

    • SLC39A11 has been identified as a longevity-associated protein

    • Knockout models show reduced lifespan, particularly in males

    • The connection to manganese homeostasis suggests potential roles in age-related decline

  • Neurodegenerative conditions:

    • Manganese dysregulation is associated with neurological disorders

    • SLC39A11's role in manganese transport suggests potential involvement in:

      • Parkinson's disease-like syndromes

      • Manganism

      • Other metal-associated neurodegeneration

  • Metabolic disorders:

    • Zinc and manganese both function as cofactors for numerous metabolic enzymes

    • Dysregulation could potentially impact insulin signaling, glucose metabolism, and lipid processing

    • Sex-specific differences in SLC39A11 knockout phenotypes suggest possible connections to sex-dependent metabolic regulation

  • Inflammation and immune function:

    • ZIP transporters have established roles in immune cell function

    • Nuclear zinc homeostasis affects transcriptional programs that may include inflammatory pathways

    • The RNA-seq data from ZIP11 knockdown cells suggests altered signaling that could affect immune responses

  • Developmental biology:

    • While SLC39A11 knockout animals develop normally, subtle developmental effects cannot be excluded

    • The altered fin structures in aging SLC39A11-deficient zebrafish suggest potential roles in tissue maintenance and regeneration

Researchers investigating these disease areas should consider SLC39A11 as a potential contributor, particularly in contexts where metal homeostasis intersects with pathological processes.

How should researchers design clinical studies to investigate ZIP11/SLC39A11 in human subjects?

When designing clinical studies to investigate ZIP11/SLC39A11 in human populations, researchers should consider:

  • Cohort selection strategies:

    • Include age-stratified groups to capture age-related effects

    • Balance male and female participants given the observed sex differences in animal models

    • Consider populations with potential metal exposure variations

    • Include appropriate controls matched for relevant demographic factors

  • Sample collection and processing:

    • Blood samples for SLC39A11 expression analysis

    • Serum/plasma for metal quantification

    • Consider tissue biopsies where ethically appropriate

    • Implement standardized collection protocols to minimize metal contamination

  • Survey methodology considerations:

    • The American Trends Panel approach provides a model for nationally representative sampling

    • Consider landline and cellphone random-digit-dial (RDD) surveys for recruitment

    • Implement appropriate weighting procedures to account for sampling biases

    • Calculate margins of sampling error (e.g., ±1.9 percentage points for n=6,251)

  • Analytical approaches:

    • Genotyping for SLC39A11 polymorphisms

    • Expression analysis in accessible tissues

    • Metal level quantification in biological samples

    • Correlation with clinical parameters and outcomes

  • Ethical considerations:

    • Obtain appropriate informed consent

    • Address potential incidental findings

    • Consider return of research results policies

    • Implement data security protocols for genetic information

The Pew Research Center's methodology for nationally representative panels provides a useful framework for designing human studies with appropriate sampling and weighting procedures .

What are the most promising areas for future ZIP11/SLC39A11 research?

Based on current knowledge and gaps in understanding, several promising research directions emerge:

  • Structural biology:

    • Determine the three-dimensional structure of human ZIP11

    • Identify metal binding sites and transport mechanisms

    • Compare with structures of related ZIP family members

    • Use structural information to design selective inhibitors

  • Expanded physiological roles:

    • Further characterize the role in manganese homeostasis

    • Investigate potential roles in other trace metals

    • Explore tissue-specific functions beyond current models

    • Examine potential roles in stem cell maintenance and differentiation

  • Disease associations:

    • Expand cancer studies beyond cervical cancer to other malignancies

    • Investigate connections to neurodegenerative conditions

    • Explore potential roles in metabolic disorders

    • Examine genetic associations in human populations

  • Therapeutic targeting:

    • Develop small molecule inhibitors specific for ZIP11

    • Explore nanoparticle-based delivery of ZIP11 modulators to specific tissues

    • Investigate combination approaches targeting multiple metal transport systems

    • Design zinc ionophores that might bypass ZIP11-dependent transport

  • Regulatory mechanisms:

    • Elucidate the transcriptional and post-translational regulation of ZIP11

    • Identify interaction partners that modulate transporter function

    • Characterize the response to cellular stressors beyond metal availability

    • Investigate epigenetic regulation across different tissues

The emerging role of SLC39A11 as both a zinc and manganese transporter with implications for cancer progression and longevity makes it a particularly promising target for interdisciplinary research spanning cell biology, structural biology, and translational medicine.

What technological advances would enhance ZIP11/SLC39A11 research?

Advancements in several technological areas would significantly accelerate ZIP11/SLC39A11 research:

  • Single-cell metal imaging technologies:

    • Development of improved fluorescent metal sensors with higher specificity

    • Enhanced spatial resolution for subcellular metal mapping

    • Multiplexed detection of multiple metals simultaneously

    • Integration with live-cell imaging platforms

  • Structural biology techniques:

    • Application of cryo-EM to membrane protein structures

    • Improved crystallization methods for metal transporters

    • Development of native mass spectrometry approaches for metal-binding studies

    • Computational modeling validated by experimental constraints

  • Genome editing advances:

    • Cell type-specific and temporally controlled CRISPR systems

    • More efficient homology-directed repair for precise modifications

    • Improved methods for introducing larger knockin constructs

    • Base editing approaches for studying specific variants

  • Experimental design methodologies:

    • Implementation of space-filling experimental designs for complex metal homeostasis studies

    • Development of specialized latin hypercube designs for multifactorial experiments

    • Application of maximum projection designs for optimal experimental efficiency

    • Integration of sliced full factorial-based designs for comprehensive parameter exploration

  • Systems biology approaches:

    • Multi-omics integration frameworks

    • Enhanced pathway analysis tools specifically for metal homeostasis

    • Network modeling of metal transport systems

    • Machine learning applications for predicting metal-dependent phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.