Recombinant Human Zinc transporter ZIP4 (SLC39A4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Zinc Transporter ZIP4 (SLC39A4)

Recombinant human ZIP4 (SLC39A4) is a bioengineered protein produced through heterologous expression systems, designed to replicate the functional properties of the native zinc transporter. Native ZIP4 is a 647-amino-acid transmembrane protein with six predicted transmembrane domains (TMDs), primarily responsible for zinc uptake in intestinal epithelial cells and maintaining cytosolic zinc homeostasis . Recombinant ZIP4 retains this core function but is optimized for research applications, including structural studies, zinc transport assays, and therapeutic target validation.

Production and Purification Methods

Recombinant ZIP4 is produced using:

  1. Prokaryotic Systems (E. coli):

    • Advantages: High yield, cost-effective.

    • Limitations: Requires refolding for proper TMD assembly .

  2. Eukaryotic Systems (mammalian cells, X. laevis oocytes):

    • Advantages: Native post-translational modifications, functional membrane integration .

    • Limitations: Lower scalability.

Purification Techniques

  • Affinity Chromatography: His-tagged proteins purified via Ni-NTA columns .

  • Gel Filtration: Used to remove aggregation and validate monodispersity.

Cancer Biology

ZIP4 overexpression is linked to tumorigenesis in pancreatic, ovarian, and nasopharyngeal cancers. Key findings:

Cancer TypeZIP4 RoleFunctional Impact
PancreaticPromotes cell proliferation, tumor growth, and metastasis 13-fold increase in tumor volume in xenograft models
OvarianRegulates cancer stem cells (CSCs) via NOTCH3 signaling ZIP4⁺ cells form tumors in vivo; limits ALDH⁺ cell efficacy
NasopharyngealEnhances epithelial-to-mesenchymal transition (EMT) and radioresistance PI3K/Akt pathway activation; reduced radiosensitivity

Zinc Homeostasis and Disease

  • Acrodermatitis Enteropathica (AE): Loss-of-function mutations in SLC39A4 cause systemic zinc deficiency .

  • Population Variations: A c.1114C>G polymorphism (rs1871534) reduces zinc uptake efficiency, potentially conferring pathogen resistance in Sub-Saharan populations .

Polymorphism Effects

VariantPopulationFunctional ImpactSignificance
Val372 (rs1871534)Sub-Saharan AfricaReduced zinc uptake efficiencyHypothesized pathogen resistance
Wild-type (Leu372)Other populationsNormal zinc uptakeReference for functional studies

Post-Translational Regulation

  • Ubiquitination: Zinc-induced degradation via the histidine-rich intracellular loop .

  • Trafficking: Zinc-responsive membrane localization critical for intestinal zinc absorption .

Diagnostic and Therapeutic Potential

  • Biomarkers: Exosomal ZIP4 identified as a pancreatic cancer biomarker .

  • Therapeutic Targets: Inhibiting ZIP4 reverses EMT and enhances radiosensitivity in nasopharyngeal cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please specify it, and we will prioritize developing the specified tag.
Synonyms
SLC39A4; ZIP4; Zinc transporter ZIP4; Solute carrier family 39 member 4; Zrt- and Irt-like protein 4; ZIP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-647
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
SLC39A4
Target Protein Sequence
SPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANGPCGKCLSVEDALGLGEPEGSGL PPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWASHADHLLALLESPKALTPGLSW LLQRMQARAAGQTPKTACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSP QYFVDFVFQQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNS SSVWDTVCLSARDVMAAYGLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLS QSERYLYGSLATLLICLCAVFGLLLLTCTGCRGVTHYILQTFLSLAVGALTGDAVLHLTP KVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLEDGPCGHSSHS HGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLSPELRLLPYMITL GDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALLLN LASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFL LHNVGLLGGWTVLLLLSLYEDDITF
Uniprot No.

Target Background

Function
Plays a crucial role in cellular zinc homeostasis by functioning as a zinc transporter. Its expression is regulated in response to zinc availability.
Gene References Into Functions
  1. Studies have shown a decreased expression of Zn uptake transporters ZIP2 and ZIP4 at both mRNA and protein levels, correlated with SHANK3 expression levels. Reduced levels of ZIP4 protein were observed co-localizing with SHANK3 at the plasma membrane. ZIP4 exists in a complex with SHANK3. Further research confirmed a link between enterocytic SHANK3, ZIP2 and ZIP4. PMID: 28345660
  2. The expression of zinc transporters ZIP4, ZIP14 and ZnT9 in hepatic carcinogenesis was investigated in an immunohistochemical study. PMID: 29895370
  3. Exosomal ZIP4 promotes cancer growth and serves as a novel diagnostic biomarker for pancreatic cancer. PMID: 30007115
  4. Structural insights into the extracellular domain of ZIP4, crucial for optimal zinc transport, have been uncovered. PMID: 27321477
  5. ZIP4 regulates human epidermal homeostasis in patients with acrodermatitis enteropathica. PMID: 27940220
  6. ZIP4 and intracellular zinc play essential roles in tumoral growth in oral squamous cell carcinoma. PMID: 28017725
  7. Case Report: A heterozygous mutation in SLC39A4 leading to acrodermatitis enteropathica was identified. PMID: 26351177
  8. Research has shown that silencing of the zinc transporter ZIP4 resulted in increased bone tissue mineral density and restored bone strength. PMID: 26305676
  9. The zinc binding properties of the large intracellular loop of hZIP4 were studied. PMID: 25882556
  10. The findings described a previously unknown role of ZIP4 in apoptosis resistance and elucidated a novel pathway through which ZIP4 regulates pancreatic cancer growth. PMID: 24553114
  11. In glioma tumors, high ZIP4 expression was significantly associated with higher grade. PMID: 25921144
  12. A structural model of ZIP4 was developed by integrating protein prediction methods with in situ experiments. Insights into the permeation pathway of ZIP4 were provided. PMID: 25971965
  13. Mutations in SLC39A4 have roles in zinc deficiency. PMID: 25391167
  14. Both acrodermatitis mutations result in the absence of ZIP4 transporter cell surface expression and nearly absent zinc uptake. PMID: 24586184
  15. ZIP4 activates the zinc-dependent transcription factor CREB and requires this transcription factor to increase miR-373 expression through the regulation of its promoter. PMID: 23857777
  16. High ZIP4 expression is associated with glioma. PMID: 23595627
  17. Findings indicate that ZIP4 is the only zinc transporter significantly upregulated in pancreatic cancer and may be the primary zinc transporter playing a significant role in pancreatic cancer growth. PMID: 23331012
  18. Results suggest that ZIP4 might be a tumor suppressor gene, and downregulation of ZIP4 may be an early critical event in the development of prostate carcinoma. PMID: 21803616
  19. Expression of two Zn(2+) influx transporters, ZIP2 and ZIP4, declines as a function of retinal pigment epithelium age. PMID: 21603979
  20. Zinc, copper(II), and nickel can be transported by human ZIP4 when the cation concentration is in the micromolar range; nickel can bind to but is not transported by human ZIP4. PMID: 22242765
  21. The transporter ZIP4 is expressed throughout the gastrointestinal tract and serves as a major processor of dietary zinc. PMID: 21462106
  22. GSPE and EGCG enhance the expression of cellular zinc importers ZIP4 (SLC39A4). PMID: 20471814
  23. Cell migration assays revealed that RNAi knockdown of Zip4 in Hepa cells suppressed in vitro migration, while forced overexpression in Hepa cells and MCF-7 cells enhanced in vitro migration. PMID: 20957146
  24. Zinc can regulate the mRNA expression of ZIP4 in Caco2 cells. PMID: 16986515
  25. Overexpression of ZIP4 led to significantly increased expression of NRP-1, VEGF, MMP-2, and MMP-9, and is associated with angiogenesis, invasion, and metastasis pathways in pancreatic cancer. PMID: 20023433
  26. ZIP4 overexpression causes increased IL-6 transcription through CREB, which in turn activates STAT3 and leads to increased cyclin D1 expression. PMID: 20160059
  27. A novel member of a zinc transporter family, hZIP4, is defective in acrodermatitis enteropathica. PMID: 12032886
  28. SLC39A4 is centrally involved in the pathogenesis of acrodermatitis enteropathica. PMID: 12068297
  29. Three novel mutations, 1017ins53, which creates a premature termination codon, and two missense mutations, R95C and Q303H, were identified. PMID: 12787121
  30. The temporal and spatial patterns of expression of the mouse ZIP1, 3, 4, and 5 genes in the developing intestine and the effects of maternal dietary zinc deficiency on these patterns of expression were examined. PMID: 16682017
  31. Ubiquitin-mediated degradation of the ZIP4 protein is critical for regulating zinc homeostasis in response to the upper tier of physiological zinc concentrations. PMID: 17202136
  32. A therapeutic strategy targeting ZIP4 to control pancreatic cancer growth has been proposed. PMID: 18003899
  33. Acrodermatitis enteropathica is a rare autosomal recessive disorder caused by mutations in SLC39A4, which encodes the tissue-specific zinc transporter ZIP4. PMID: 18328205
  34. The clinical manifestations in three acrodermatitis enteropathica patients with a novel mutation were investigated. PMID: 19416242
  35. Results suggest that exon 9 in the SLC39A4 gene encompassing c.1438G should be screened first in the molecular diagnosis of Japanese patients with Acrodermatitis Enteropathic. PMID: 19416256
  36. Knocking down ZIP4 by short hairpin RNA might be a novel treatment strategy for pancreatic cancers with ZIP4 overexpression. PMID: 19755388

Show More

Hide All

Database Links

HGNC: 17129

OMIM: 201100

KEGG: hsa:55630

STRING: 9606.ENSP00000301305

UniGene: Hs.521934

Involvement In Disease
Acrodermatitis enteropathica, zinc-deficiency type (AEZ)
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Note=Colocalized with TFRC in the recycling endosomes. Cycles between endosomal compartments and the plasma membrane in response to zinc availability.
Tissue Specificity
Highly expressed in kidney, small intestine, stomach, colon, jejunum and duodenum.

Q&A

What is the basic structure and function of human ZIP4 (SLC39A4)?

Human ZIP4 is a selective transporter predominantly mediating the uptake of Zn²⁺ ions across cellular membranes. Structurally, it contains:

  • An N-terminal extracellular domain (ECD)

  • 8 transmembrane domains forming the transport pathway

  • Several cytosolic loops, particularly the second loop (L2) which contains important regulatory elements

  • Histidine-rich regions in both the ECD and L2 that bind zinc with different affinities

Functionally, ZIP4 serves as the primary zinc uptake transporter in intestinal cells, though it also exhibits polyspecific binding and transport of other divalent metal ions including Cu²⁺, Cd²⁺, and possibly Ni²⁺ at higher concentrations . ZIP4's zinc uniporter activity is regulated by zinc availability, allowing cells to adjust zinc uptake according to nutritional status .

How does ZIP4 interact with other zinc transporters?

ZIP4 functions within the broader network of zinc homeostasis by interacting with other transporters including ZIP-1 and ZIP-10 . While direct physical interactions between these transporters haven't been extensively characterized, they operate in a coordinated manner to maintain proper cellular zinc levels. In experimental designs investigating ZIP4 function, researchers should consider:

  • The expression levels of other zinc transporters that might compensate for ZIP4 modulation

  • Using cell lines with minimal expression of other zinc transporters when isolating ZIP4-specific effects

  • Employing specific inhibitors or RNAi approaches targeting multiple transporters to dissect their relative contributions

What are the mechanisms regulating ZIP4 expression and activity?

ZIP4 regulation occurs at multiple levels:

Transcriptional regulation:

  • Activated during zinc deficiency

  • Elevated in certain cancers, particularly hepatocellular carcinoma and pancreatic cancer

Post-translational regulation:

  • Zinc-dependent endocytosis: At high zinc concentrations, ZIP4 is rapidly internalized from the cell membrane (occurs within minutes)

  • Recycling: Under zinc-deficient conditions, internalized ZIP4 is recycled back to the cell surface

  • Degradation: Prolonged high zinc exposure leads to ubiquitination and degradation of ZIP4

This multi-tiered regulation allows for both rapid adjustment (endocytosis/recycling) and long-term adaptation (transcriptional changes) to zinc availability.

How does zinc binding trigger ZIP4 endocytosis?

Zinc-dependent endocytosis of ZIP4 involves specific molecular mechanisms:

  • Zinc sensing: The transport site within the transmembrane domain serves as the zinc sensor, with hZIP4 functioning as a "transceptor" (both transporter and receptor)

  • Structural coupling: Zinc binding to the transport site induces conformational changes that couple to the second cytosolic loop (L2)

  • Endocytic signal exposure: A conserved Leu-Gln-Leu (LQL) motif in L2 is required for ZIP4 endocytosis, likely becoming accessible to the endocytic machinery following zinc-induced conformational changes

Contrary to earlier hypotheses, the histidine-rich regions in the extracellular domain and the HxH motif in the transmembrane region do not significantly contribute to zinc sensing in human ZIP4, although there may be species-specific differences (e.g., in mouse ZIP4) .

How is ZIP4 involved in cancer progression?

ZIP4 has been implicated in multiple aspects of cancer biology:

Overexpression patterns:

  • Dramatically elevated in hepatocellular carcinomas compared to surrounding tissues

  • Overexpressed in pancreatic cancer, promoting tumor growth

  • Potentially elevated in lymphoma, melanoma, and metastatic colon cancer according to database meta-analysis

Molecular mechanisms in cancer:

  • Promotes pancreatic cancer invasiveness and metastasis by repressing tight junction proteins

  • Establishes a signaling pathway involving:

    • Downregulation of ZO-1 and claudin-1 via the transcriptional repressor ZEB1

    • Subsequent upregulation of FAK and Paxillin phosphorylation

    • Enhanced cell migration and invasion

Cancer TypeZIP4 ExpressionAssociated MechanismsReference
Pancreatic CancerOverexpressedZO-1/claudin-1 repression via ZEB1
Hepatocellular CarcinomaDramatically elevatedFound in both human samples and mouse models (FXR-knockout, Mdr2-knockout, Trnip transgenic)
Other CancersElevated in some casesAmong top 10% of genes expressed in many cancer types, often in aggressive stages

What genetic disorders are associated with ZIP4 mutations?

Mutations in ZIP4 (SLC39A4) can lead to a lethal genetic disorder known as Acrodermatitis enteropathica, characterized by:

  • Severe zinc deficiency despite adequate dietary zinc intake

  • Manifestations including dermatitis, alopecia, and diarrhea

  • Growth retardation and immune dysfunction

Research approaches to study these mutations include:

  • Expression of mutant ZIP4 in heterologous systems to assess zinc transport capacity

  • Structure-function analyses to determine how specific mutations affect zinc binding, transport, or trafficking

  • Cell-based assays to measure zinc uptake deficiencies associated with patient-derived mutations

What are the optimal methods for detecting ZIP4 expression in research samples?

Several complementary approaches can be used for ZIP4 detection:

Protein detection:

  • Western blot: Using membrane preparation protocols with proper controls. ZIP4 appears as a ≈73 kDa band, often with larger aggregates also visible

  • Immunohistochemistry: Effective for tissue sections, showing distinct localization patterns in normal versus diseased tissues

  • Flow cytometry: Can be used to assess surface expression versus internalization

mRNA detection:

  • Northern blot: Can reveal transcript levels in total RNA preparations

  • qRT-PCR: For more sensitive quantification of transcript levels

  • RNA-seq: For broader transcriptomic analysis including ZIP4 expression

When performing these assays, researchers should:

  • Include appropriate controls (ZIP1 is often used as a membrane protein loading control)

  • Consider zinc status of samples, as this affects ZIP4 expression and localization

  • Use validated antibodies specific to the species being studied (human versus mouse ZIP4)

How can researchers effectively express and purify recombinant ZIP4 for in vitro studies?

Producing functional recombinant ZIP4 presents several challenges due to its multiple transmembrane domains. Recommended approaches include:

Expression systems:

  • Mammalian cell lines: HEK293T cells have been successfully used

  • Xenopus laevis oocytes: Effective for functional transport studies

  • Yeast expression systems: For higher yield protein production

Purification strategies:

  • Detergent solubilization: Critical for extracting membrane-embedded ZIP4

  • Affinity tags: His-tags or FLAG-tags can facilitate purification

  • Size exclusion chromatography: To separate monomeric from aggregated forms

Functional verification:

  • Transport assays using radioisotope-labeled zinc or fluorescent zinc probes

  • Binding assays for zinc and other potential substrates

  • Structural integrity assessment through circular dichroism or limited proteolysis

How does the structural coupling between ZIP4's transport site and cytosolic loops regulate its endocytosis?

The zinc-dependent endocytosis of ZIP4 involves complex structural dynamics:

  • Transport site as zinc sensor: Mutations in the transmembrane domain that disrupt zinc transport also impair zinc sensing for endocytosis, suggesting the transport pathway itself acts as the primary zinc sensor

  • Conformational coupling: Partial proteolysis experiments with purified hZIP4 demonstrate structural coupling between the transport site and the second cytosolic loop (L2) upon zinc binding

  • Signal exposure: The conformational change likely exposes the conserved LQL motif in L2, which serves as the endocytic signal

Advanced research approaches to further investigate this mechanism include:

  • Cryo-EM studies of ZIP4 in different conformational states (with/without zinc)

  • FRET-based assays to detect real-time conformational changes upon zinc binding

  • Crosslinking studies to capture transient interaction states between the transport domain and cytosolic loops

What is the relationship between ZIP4's transport function and its role as a signaling molecule in cancer?

ZIP4 exhibits dual functionality as both a transporter and signaling molecule:

  • Transport-dependent effects: Some oncogenic effects likely depend on increased zinc uptake, which may:

    • Activate zinc-dependent transcription factors

    • Influence metalloproteases involved in matrix remodeling and invasion

    • Alter cellular metabolism

  • Transport-independent signaling: ZIP4 may also function as a transceptor, where:

    • Conformational changes upon zinc binding trigger signaling cascades

    • Interactions with other membrane or cytosolic proteins initiate downstream effects

    • ZIP4-mediated repression of ZO-1 and claudin-1 involves the transcriptional repressor ZEB1

Experimental approaches to distinguish these functions include:

  • Using transport-deficient ZIP4 mutants to separate transport from signaling roles

  • Investigating ZIP4 interactome under different zinc conditions

  • Analyzing downstream signaling pathway activation with phosphoproteomic approaches

What are common challenges in ZIP4 knockdown/overexpression studies and how can they be addressed?

Researchers frequently encounter several issues when manipulating ZIP4 expression:

For knockdown studies:

  • Incomplete knockdown: Use multiple RNAi sequences targeting different regions of ZIP4 mRNA

  • Compensation by other zinc transporters: Consider dual knockdown approaches

  • Cell viability issues: Monitor zinc supplementation requirements after ZIP4 knockdown

For overexpression studies:

  • Protein aggregation: Optimize expression levels to avoid overloading cellular machinery

  • Improper localization: Confirm membrane targeting using surface biotinylation or microscopy

  • Functional verification: Always confirm transporter activity using zinc uptake assays

General considerations:

  • Control for zinc levels in culture media, as they affect endogenous ZIP4 expression and localization

  • Include appropriate vectors/scrambled controls for all genetic manipulations

  • Validate antibodies for specificity, particularly when detecting overexpressed versus endogenous protein

How should researchers design experiments to study ZIP4's role in zinc homeostasis versus its involvement in pathological processes?

When investigating the dual roles of ZIP4, consider these methodological approaches:

For physiological zinc homeostasis studies:

  • Use zinc depletion (using chelators like TPEN or Chelex-treated serum) and zinc supplementation to trigger regulatory responses

  • Monitor both ZIP4 localization and expression levels in response to zinc changes

  • Consider the temporal aspects of ZIP4 regulation (acute responses versus chronic adaptation)

For pathological process investigations:

  • Compare ZIP4 expression between normal and disease tissues using paired samples when possible

  • Correlate ZIP4 expression with clinical outcomes and disease progression markers

  • Use genetic models (knockout/knockin) or xenograft models to assess causal relationships

Integrated approaches:

  • Determine whether pathological effects are dependent on zinc transport by using transport-deficient mutants

  • Investigate whether disease-associated mutations affect zinc homeostasis, trafficking, or both

  • Consider compensatory mechanisms that might mask phenotypes in knockout models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.