Recombinant Human Zinc transporter ZIP5 (SLC39A5)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Zinc Homeostasis

ZIP5 mediates zinc uptake from extracellular spaces or intracellular compartments into the cytoplasm. Key functions include:

  • Zinc Excretion Regulation: Coordinates basolateral zinc transport in intestinal enterocytes, modulating systemic zinc levels .

  • Pancreatic Protection: Prevents zinc toxicity in acinar cells by regulating zinc retention, thereby reducing risks of acute pancreatitis .

  • Metabolic Modulation: Inactivation of Slc39a5 in mice elevates hepatic zinc, activating AMPK/AKT signaling to improve glucose metabolism and liver function in obesity models .

Disease Associations

  • Myopia: Rare mutations in SLC39A5 are linked to autosomal dominant high myopia (MYP24) via dysregulated BMP/TGF-β signaling in scleral fibroblasts .

  • Cancer: ZIP5 knockdown inhibits esophageal squamous cell carcinoma (ESCC) progression by suppressing COX2, cyclin D1, and E-cadherin .

  • Type 2 Diabetes (T2D): Loss-of-function SLC39A5 variants correlate with elevated circulating zinc and reduced T2D risk in humans .

Mechanistic Insights

Study ModelKey FindingCitation
Slc39a5<sup>-/-</sup> miceHepatic zinc accumulation activates AMPK, improving insulin sensitivity
Pancreas-specific ZIP5 KOIncreased susceptibility to zinc-induced pancreatitis and vacuole formation
ESCC cell linesZIP5 silencing reduces proliferation, migration, and invasion

Future Directions

Current research focuses on:

  • Therapeutic targeting of ZIP5 for metabolic disorders (e.g., NAFLD, T2D) .

  • Role in autophagy and zymophagy pathways during pancreatic stress .

  • Structural studies to resolve zinc-binding dynamics using cryo-EM .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
SLC39A5; ZIP5; Zinc transporter ZIP5; Solute carrier family 39 member 5; Zrt- and Irt-like protein 5; ZIP-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-540
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SLC39A5
Target Protein Sequence
WVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGP LTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLL HRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGA PAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGD ALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRR KRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGG TDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGL SFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRP PEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG
Uniprot No.

Target Background

Function
Zinc transporter ZIP5 (SLC39A5) may play a role in polarized cells by facilitating serosal-to-mucosal zinc transport. It appears to play a crucial role in regulating organismal zinc status. It could regulate the BMP/TGF-beta (bone morphogenetic protein/transforming growth factor-beta) signaling pathway and modulate extracellular matrix (ECM) proteins of the sclera. ZIP5 plays a role in eye development.
Gene References Into Functions
  1. We discovered that downregulation of ZIP5 through RNA interference inhibited esophageal cancer growth in vivo, reduced COX2 expression, and promoted E-cadherin expression. PMID: 27458102
  2. ZIP5 knockdown suppressed the proliferation, migration, and invasion of ESCC and downregulated COX2, cyclin D1, and E-cadherin expression, thereby inhibiting cell progression in esophageal squamous cell carcinoma. PMID: 26133979
  3. Mutation in LRPAP1 is associated with high myopia. Further research is warranted to evaluate the pathogenicity of variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2. PMID: 25525168
  4. Zip5 protein is a zinc transporter that localizes to the basolateral surface of polarized cells. PMID: 15322118
Database Links

HGNC: 20502

OMIM: 608730

KEGG: hsa:283375

STRING: 9606.ENSP00000266980

UniGene: Hs.591018

Involvement In Disease
Myopia 24, autosomal dominant (MYP24)
Protein Families
ZIP transporter (TC 2.A.5) family
Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver, kidney, pancreas, small intestine, colon, spleen, fetal liver and fetal kidney.

Q&A

What is the basic structure of SLC39A5 and how does it differ from other ZIP family transporters?

SLC39A5 (ZIP5) belongs to the ZIP family of zinc transporters that typically have eight transmembrane domains (TMDs). While the transmembrane domains are highly conserved among ZIP proteins, ZIP5 contains variable regions in the cytoplasmic histidine-rich intracellular loop between TMDs III and IV or the extracellular amino-terminal portion . ZIP proteins are thought to form homodimers to transport zinc across cellular membranes.

Unlike other ZIP transporters, ZIP5 shows distinctive characteristics in its regulation and localization. It uniquely localizes to the basolateral membranes of intestinal enterocytes and pancreatic acinar cells, whereas many other ZIP transporters localize to different cellular compartments. The baso-lateral localization and zinc-regulation of ZIP5 are unique among the 14 members of the Slc39a family, suggesting a specialized role in zinc homeostasis .

What are the key functional domains of SLC39A5 that researchers should consider when designing recombinant constructs?

When designing recombinant constructs of SLC39A5, researchers should carefully consider several functional domains:

  • Transmembrane domains: The eight predicted TMDs are essential for proper membrane insertion and zinc transport function

  • The histidine-rich intracellular loop between TMDs III and IV: This region may be involved in zinc binding or sensing

  • The CHEXPHEXGD motif in TMD V: This conserved motif may determine metal specificity

  • The N-terminal region: This portion may contain targeting signals for basolateral localization

In knockout studies, researchers have targeted specific regions, such as removing the entire transmembrane domain of ZIP5 by deleting exons 5-12, leaving only exons 1-4 intact . This approach effectively eliminates zinc transport function while preserving the N-terminal portion of the protein.

How does SLC39A5 mediate zinc transport across cellular membranes?

SLC39A5 mediates zinc transport across cellular membranes by functioning as a zinc importer, transporting zinc from the extracellular environment into the cytosol. Like other ZIP family transporters, ZIP5 likely uses a mechanism that involves conformational changes upon zinc binding.

The protein localizes specifically to the basolateral membranes of intestinal enterocytes and pancreatic acinar cells. In enterocytes, ZIP5 appears to transport zinc from the bloodstream into the intestinal epithelium, which is then likely excreted into the intestinal lumen. This directional transport is critical for zinc excretion from the body. In pancreatic acinar cells, ZIP5 seems to facilitate zinc uptake from the bloodstream, contributing to zinc accumulation and retention in the pancreas .

What expression systems are most effective for producing recombinant SLC39A5 protein?

For recombinant SLC39A5 production, researchers can use several expression systems, each with distinct advantages:

  • E. coli and yeast systems: Provide higher yields and shorter turnaround times, suitable for basic structural studies or antibody production

  • Insect cell expression with baculovirus: Offers proper post-translational modifications necessary for correct protein folding

  • Mammalian cell expression systems: Provide the most native-like post-translational modifications and are recommended for functional studies

For specific research applications, consider the following methodological approaches:

For structural studies:

  • Cell-free expression systems have been used successfully to produce recombinant transmembrane proteins like SLC39A5

  • When expressing in E. coli, optimization of codons and inclusion of solubility tags may improve yield

For functional studies:

  • HEK293 cells can be used to express SLC39A5 with tags such as His, DDK, Myc, GST, Avi, or Fc

  • For zinc transport assays, mammalian cells expressing the recombinant protein are ideal

The expression system choice should align with your specific research goals. If protein function is critical, mammalian expression is recommended despite lower yields. If high quantities are needed for structural studies or antibody production, E. coli or yeast systems may be preferable.

What are the most reliable methods for measuring SLC39A5-mediated zinc transport in experimental settings?

Several methodological approaches can be used to measure SLC39A5-mediated zinc transport:

  • Stable isotope tracing: Using stable isotopes like 67Zn allows for precise tracking of zinc movement across cell membranes. This approach was successfully used in knockout mouse studies to measure zinc accumulation and retention in tissues . The natural ratio of 67Zn/66Zn is 0.146, and changes in this ratio can be measured to quantify zinc transport.

  • Fluorescent zinc probes: Zinc-specific fluorescent probes such as FluoZin-3 can be used to measure intracellular zinc levels in real-time in cells expressing recombinant SLC39A5.

  • Radioactive 65Zn uptake assays: These provide a sensitive measure of zinc transport activity over time in cells expressing SLC39A5.

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry): This technique allows for precise measurement of total zinc content in cells or tissues expressing SLC39A5.

When designing transport experiments, consider:

  • Including appropriate controls (cells expressing non-functional SLC39A5 mutants)

  • Testing zinc transport at different external zinc concentrations

  • Examining transport kinetics over time

  • Evaluating the effects of potential inhibitors or competitors

Interpretation of results should account for the expression level of the recombinant protein and any potential contributions from endogenous zinc transporters.

How can researchers generate and validate SLC39A5 knockout models for functional studies?

Generation and validation of SLC39A5 knockout models require careful methodological approaches:

Generation methods:

  • Conditional knockout using Cre-loxP system: This approach allows for tissue-specific deletion of SLC39A5. In previous studies, researchers generated floxed ZIP5 mice by inserting LoxP sites flanking critical exons (e.g., placing a LoxP site in intron 4 and another after the last exon), which allowed for deletion of the entire transmembrane domain upon Cre recombination .

  • Inducible knockout systems: Using tamoxifen-inducible Cre-ERT2 recombinase under tissue-specific promoters (like villin for intestinal epithelium or elastase for pancreatic acinar cells) enables temporal control of gene deletion .

  • CRISPR-Cas9 technology: For cell culture models, CRISPR-Cas9 can efficiently generate SLC39A5 knockout cell lines.

Validation approaches:

  • Genotyping: Confirm gene deletion using PCR with primers flanking the deleted region. For example, 5′ integration screening that amplifies products from wild-type and floxed alleles, with distinct patterns after restriction enzyme digestion .

  • mRNA analysis: Northern blot or qRT-PCR to confirm reduction of SLC39A5 transcripts. Previous studies showed >90% reduction in intestine-specific knockout mice .

  • Protein analysis: Immunohistochemistry or Western blotting to confirm absence of ZIP5 protein. IHC can reveal mosaic patterns in conditional knockouts with incomplete recombination .

  • Functional validation: Measure zinc levels in relevant tissues (e.g., pancreas, liver) using elemental analysis to confirm physiological impact of ZIP5 deletion .

For tissue-specific knockouts, expect efficacy ranges of 70-90%, as observed in previous studies . This mosaicism should be considered when interpreting results.

What are the differences in ZIP5 function between intestinal enterocytes and pancreatic acinar cells?

ZIP5 exhibits distinct functions in intestinal enterocytes versus pancreatic acinar cells, as revealed by tissue-specific knockout studies:

Intestinal enterocytes:

  • ZIP5 primarily functions in zinc excretion, taking up zinc from the bloodstream across the basolateral membrane into enterocytes

  • Intestine-specific ZIP5 knockout (Intest KO) led to increased pancreatic zinc (approximately 60% higher) in mice fed a zinc-adequate diet

  • Loss of intestinal ZIP5 also caused increased abundance of intestinal Zip4 mRNA, suggesting compensatory regulation

  • These findings demonstrate that intestinal ZIP5 plays a crucial role in preventing excessive zinc accumulation in other tissues, particularly the pancreas

Pancreatic acinar cells:

  • ZIP5 in acinar cells appears involved in zinc accumulation and retention rather than excretion

  • Pancreas-specific ZIP5 knockout (Panc KO) modestly reduced pancreatic zinc in mice fed a zinc-adequate diet

  • While ZIP5 is not essential for acute zinc uptake in the pancreas, it contributes to zinc retention over time. After 27 hours post-67Zn injection, control mice retained significantly more pancreatic 67Zn than Panc KO mice (13.2-fold increase vs. 7.07-fold increase over control)

  • Pancreatic ZIP5 plays a protective role against zinc-induced pancreatitis

This tissue-specific functional divergence highlights the complex role of ZIP5 in maintaining zinc homeostasis across different organs. The protein's common basolateral localization in both cell types suggests a coordinated system for regulating body zinc levels, with intestinal ZIP5 controlling excretion and pancreatic ZIP5 contributing to proper zinc utilization and protection against toxicity.

What phenotypes are observed in tissue-specific versus complete ZIP5 knockout models?

Comparative analysis of tissue-specific versus complete ZIP5 knockout models reveals distinct phenotypes:

Complete ZIP5 knockout:

Intestine-specific ZIP5 knockout (Intest KO):

  • Approximately 60% increase in pancreatic zinc in mice fed a zinc-adequate diet

  • Increased abundance of intestinal Zip4 mRNA, suggesting compensatory mechanisms

  • Continued accumulation of higher levels of pancreatic zinc even when dietary zinc was restricted

  • No significant differences in zinc content in other organs examined

Pancreas-specific ZIP5 knockout (Panc KO):

  • Modest reduction in pancreatic zinc in mice fed a zinc-adequate diet

  • Normal acute zinc uptake but impaired zinc retention over time

  • Increased susceptibility to zinc-induced pancreatitis

  • Development of remarkably large cytoplasmic vacuoles in acinar cells following zinc treatment, as shown in Table 1 :

GenotypeLarge Cytoplasmic VacuolesPeripancreatic Inflammation
Zip5 Panc KONosevere
Yesmoderate
Yessevere
Yes (prominent)severe
Yes (prominent)severe
Yes (prominent)severe
Yessevere
No (atrophy of acinar cells)severe
No (atrophy of acinar cells)severe
ControlNomild to moderate
Nomoderate
Nomoderate
Nomoderate

These differential phenotypes highlight the tissue-specific roles of ZIP5 and demonstrate how disrupting zinc transport in one organ can have systemic effects on zinc homeostasis throughout the body.

How are mutations in SLC39A5 linked to myopia and other human diseases?

Mutations in SLC39A5 have been associated with several human diseases, most notably:

Myopia 24, Autosomal Dominant (MYP24):

  • SLC39A5 mutations have been directly linked to autosomal dominant high myopia

  • The association suggests that zinc homeostasis plays a critical role in proper eye development

  • The biological process annotations for SLC39A5 include eye development, further supporting this connection

Potential role in cancer progression:

  • Research indicates that ZIP5 knockdown inhibited the proliferation, migration, and invasion of esophageal squamous cell carcinoma (ESCC)

  • ZIP5 knockdown suppressed COX2, cyclin D1, and E-cadherin expression, leading to inhibition of cell progression in ESCC

  • These findings suggest SLC39A5 may play a role in cancer pathogenesis, though more research is needed

Implications in zinc-related disorders:

  • Given ZIP5's role in zinc homeostasis, dysregulation may contribute to various zinc-related pathologies

  • Pancreatic ZIP5 plays a protective role against zinc-induced pancreatitis

  • The protein is involved in the BMP signaling pathway, cellular zinc ion homeostasis, and positive regulation of nuclear mRNA splicing , suggesting potential impacts in related disease processes

When investigating SLC39A5 mutations in disease contexts, researchers should consider:

  • The tissue-specific expression and function of ZIP5

  • Potential compensatory mechanisms by other zinc transporters

  • The broader impact on zinc homeostasis throughout the body

  • How alterations in zinc levels might affect zinc-dependent processes and pathways

What protective role does SLC39A5 play in zinc-induced pancreatitis and how does this relate to autophagy mechanisms?

SLC39A5 plays a significant protective role in zinc-induced pancreatitis through mechanisms potentially involving autophagy:

Evidence for protective function:

  • Pancreas-specific ZIP5 knockout (Panc KO) mice developed more severe peri-pancreatic inflammation following zinc treatment compared to control mice

  • 8/9 Panc KO mice showed severe peri-pancreatic inflammation versus mild to moderate inflammation in controls

  • Formation of remarkably large cytoplasmic vacuoles was observed in 6/9 Panc KO mice but was rare or absent in controls

  • Acinar cell atrophy was present in 2/9 Panc KO mice but absent in all control mice

Connection to zymophagy:

  • Research suggests ZIP5 may play a role in zymophagy, defined as the selective autophagy of secretory granules

  • The large cytoplasmic vacuoles observed in Panc KO mice contained secretory proteins, suggesting disrupted processing of secretory granules

  • Without ZIP5, normal autophagy of secretory proteins appears compromised, potentially leading to cellular stress and damage

Proposed mechanism:

  • Zinc accumulation in acinar cells normally triggers protective mechanisms including appropriate autophagic responses

  • ZIP5 may help regulate intracellular zinc levels or distribution to support proper autophagic processes

  • In the absence of ZIP5, excessive or mislocalized zinc may disrupt normal autophagy pathways

  • The disrupted autophagy leads to accumulation of large vacuoles containing secretory proteins

  • This accumulation eventually contributes to acinar cell damage and inflammation

This relationship between ZIP5, zinc homeostasis, and autophagy represents an important area for future research, particularly in understanding pancreatic pathology and developing potential therapeutic approaches for pancreatitis.

How do post-translational modifications affect SLC39A5 function and how should researchers account for these in experimental designs?

Post-translational modifications (PTMs) significantly impact SLC39A5 function and must be carefully considered in experimental designs:

Critical PTMs affecting SLC39A5:

  • Glycosylation: As a transmembrane protein, SLC39A5 likely undergoes N-linked glycosylation in the secretory pathway, which may be essential for proper folding and trafficking

  • Phosphorylation: Cytoplasmic domains may contain phosphorylation sites that regulate transporter activity or trafficking

  • Ubiquitination: During zinc deficiency, ZIP5 is internalized and degraded , suggesting ubiquitin-mediated trafficking to lysosomes or proteasomes

Experimental design considerations:

  • Expression system selection:

    • Mammalian cell expression systems provide the most native-like PTMs

    • Insect cell expression with baculovirus offers many necessary PTMs for proper folding

    • E. coli lacks machinery for most eukaryotic PTMs and should be avoided for functional studies

  • Protein tagging strategies:

    • Consider tag position carefully to avoid disrupting PTM sites

    • C-terminal tags are generally preferable as they're less likely to interfere with N-terminal signal sequences and PTMs

    • Verify that tagged proteins maintain proper localization and function

  • PTM analysis approaches:

    • Mass spectrometry to identify and quantify specific PTMs

    • Site-directed mutagenesis of potential PTM sites to assess functional significance

    • Pharmacological inhibitors of specific PTM enzymes to evaluate their role in ZIP5 regulation

  • Trafficking studies:

    • Include experimental conditions that mimic zinc deficiency to study regulated internalization and degradation

    • Use fluorescent protein fusions or antibody labeling to track protein trafficking

    • Consider live-cell imaging to monitor real-time changes in protein localization

Researchers should be aware that some AE-causing mutations in mouse Zip4 result in trafficking defects to the plasma membrane, likely due to misfolding and/or mislocalization in the secretory pathway . Similar mechanisms may affect SLC39A5 function in disease states or experimental mutations.

What are the key considerations for designing functional studies to investigate SLC39A5's role in zinc-responsive pathways?

Designing functional studies to investigate SLC39A5's role in zinc-responsive pathways requires careful methodological planning:

Experimental design framework:

  • Zinc concentration and exposure protocols:

    • Use physiologically relevant zinc concentrations (typically 1-100 μM for extracellular studies)

    • Consider both acute and chronic zinc exposure paradigms

    • Include proper zinc chelators (e.g., TPEN) as controls

    • For in vivo studies, use appropriate dietary zinc levels (zinc-adequate, zinc-deficient, zinc-excess) as established in previous studies

  • Model systems selection:

    • Cell culture: Use cell types that naturally express ZIP5 (intestinal, pancreatic) or stably transfected cells

    • Animal models: Consider both global and tissue-specific knockout approaches

    • Organoid cultures: Intestinal or pancreatic organoids provide three-dimensional tissue-like systems

  • Downstream pathway analysis:

    • BMP signaling pathway: ZIP5 has been annotated to participate in this pathway

    • Cellular zinc homeostasis mechanisms: Other zinc transporters, metallothioneins

    • Nuclear mRNA splicing: ZIP5 has been implicated in positive regulation of nuclear mRNA splicing via spliceosome

    • Consider zinc-dependent transcription factors (e.g., MTF-1)

  • Readout selection:

    • Transcriptional changes: RNA-seq or qRT-PCR for zinc-responsive genes

    • Protein expression and modification: Western blotting, proteomics

    • Cellular phenotypes: Proliferation, migration, secretion

    • Subcellular zinc distribution: Zinc-specific fluorescent probes

    • For pancreatitis models: Histological analysis, inflammatory markers, vacuole formation

Key methodological approaches:

  • For reciprocal regulation studies with ZIP4:

    • Simultaneously monitor ZIP4 and ZIP5 expression/localization under varying zinc conditions

    • Use ZIP4/ZIP5 double knockout models to assess compensatory mechanisms

  • For zinc-induced pancreatitis studies:

    • Use standardized zinc injection protocols (e.g., 6.25 mg zinc/kg body weight I.P.)

    • Evaluate histopathological changes 24-48 hours post-injection

    • Quantify inflammatory markers and vacuole formation as shown in previous studies

  • For translation regulation studies:

    • Investigate the role of the 3′-untranslated region that forms a stable stem-loop structure

    • Assess potential microRNA interactions that may regulate ZIP5 translation during zinc deficiency

How should researchers interpret conflicting data about SLC39A5 function across different experimental systems and tissue contexts?

Interpreting conflicting data about SLC39A5 function requires a nuanced approach that considers multiple factors:

Sources of experimental variation to consider:

  • Tissue-specific functions:

    • SLC39A5 exhibits different functions in intestinal enterocytes (zinc excretion) versus pancreatic acinar cells (zinc retention)

    • Conflicting results may reflect genuine biological differences rather than experimental inconsistencies

    • When comparing studies, first determine whether the same tissue/cell type was examined

  • Zinc status context:

    • ZIP5 regulation and function varies dramatically depending on zinc status

    • During zinc deficiency, ZIP5 is internalized and degraded

    • During zinc adequacy or excess, ZIP5 localizes to the basolateral membrane

    • Verify zinc conditions were comparable between studies showing conflicting results

  • Experimental models and systems:

    • Recombinant expression systems vary in their post-translational modification capabilities

    • Cell lines may express different complements of other zinc transporters

    • Primary cells versus immortalized lines may show different zinc handling

    • Animal models may have strain-specific differences in zinc metabolism

Analytical framework for resolving conflicts:

  • Methodological comparison:

    • Examine differences in protein expression levels between studies

    • Compare subcellular localization determination methods

    • Assess zinc measurement techniques and their sensitivity

    • Consider knockout efficiency in genetic models (e.g., mosaic expression in conditional knockouts)

  • Integrative data analysis:

    • Triangulate findings using multiple experimental approaches

    • Consider both in vitro and in vivo evidence

    • Weigh direct measurements more heavily than indirect evidence

    • Develop mathematical models that account for tissue-specific parameters

  • Biological context interpretation:

    • Consider compensatory mechanisms that may mask phenotypes

    • Examine results in light of whole-organism zinc homeostasis

    • Evaluate whether conflicting results might reflect different aspects of ZIP5 function

    • Consider developmental timing and age-related differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.