Recombinant Huperzia lucidula ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

General Information

Huperzia lucidula ATP synthase subunit b, chloroplastic (atpF) is a specific subunit of the ATP synthase enzyme in Huperzia lucidula . ATP synthase, also known as F0F1-ATPase, is a protein complex that catalyzes the synthesis of ATP using a proton gradient across a membrane . The atpF gene encodes the subunit b protein, which is a component of the F0 sector of ATP synthase . The F0 sector is embedded in the chloroplast membrane and forms a channel through which protons flow .

Synonyms: ATP synthase subunit b, chloroplastic; ATP synthase F(0) sector subunit b; ATPase subunit I

Molecular Weight: While the exact molecular weight may vary slightly depending on post-translational modifications, the molecular weight is around 0 .

Structure and Function

ATP synthase is composed of two main parts, F0 and F1. The F0 sector is an integral membrane protein complex that contains the proton channel. Subunit b, encoded by the atpF gene, is a crucial part of the F0 sector, which is essential for proton translocation . The F1 sector is a peripheral membrane protein complex that contains the catalytic sites for ATP synthesis. The proton flow through F0 drives the rotation of a ring of subunits, which in turn drives the synthesis of ATP in the F1 sector. Subunit b is vital for the structural integrity and function of the ATP synthase complex .

Research and Applications

The study of ATP synthase subunits, including subunit b, is important for understanding the bioenergetics in plants. Research on atpF contributes to understanding the molecular mechanisms of ATP synthesis and energy conversion in photosynthetic organisms .

matK and Intron Splicing

The matK gene, found in land plants, is involved in splicing group II introns, including those in atpF . matK encodes a maturase-like protein that aids in the removal of these introns, which is essential for proper protein translation . Studies have shown that a functional matK gene is necessary for the excision of group II introns in plastid genes like atpF .

Suppliers

The following table shows potential suppliers of Recombinant Huperzia lucidula ATP synthase subunit b, chloroplastic (atpF):

SupplierTelCountryProdListAdvantage
CUSABIO TECHNOLOGY LLC027-87196173China3304458

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
atpF
Target Protein Sequence
MKNVIDFVIISGYWPPAGGFGLNANLLETNLINSGVVLGLPVYSGKGVLSNLLNNRKQTI LSTIRDAEERYEEATDKLKQARTRLQQAKIKADEIRINGLSRMEGEKQDLVDSADGNSKR LEDSKNATIRFEEQRAIEQVRQQVSRLALERALEVLNIRLNSELQSRMIDYHIDLLVRAA ENTTD
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the basic structure and function of Huperzia lucidula ATP synthase subunit b, chloroplastic (atpF)?

    ATP synthase subunit b (atpF) is a critical component of the chloroplastic ATP synthase F0 sector. In Huperzia lucidula, the protein consists of 185 amino acids with the following sequence: MKNVIDFVIISGYWPPAGGFGLNANLLETNLINSGVVLGLPVYSGKGVLSNLLNNRKQTILSTIRDAEERYEEATDKLKQARTRLQQAKIKADEIRINGLSRMEGEKQDLVDSADGNSKRLEDSKNATIRFEEQRAIEQVRQQVSRLALERALEVLNIRLNSELQSRMIDYHIDLLVRAAENTTD . Functionally, it serves as part of the membrane-embedded F0 portion of ATP synthase, which forms a proton channel and is essential for energy transduction. The protein plays a crucial role in maintaining the structural integrity of the ATP synthase complex and facilitating proton movement required for ATP synthesis.

  • How does Huperzia lucidula atpF differ from other plant species' ATP synthase subunit b proteins?

    Comparative analysis shows that while the core function remains conserved, there are significant sequence variations between Huperzia lucidula atpF and other plant species. For example, when compared with Welwitschia mirabilis atpF (182 amino acids), the Huperzia protein exhibits approximately 65% sequence similarity . These differences reflect evolutionary divergence while maintaining functional domains. Lycophytes like Huperzia represent an early branch in vascular plant evolution, making their ATP synthase components valuable for studying the evolution of photosynthetic machinery. Notably, Huperzia atpF contains unique regions that may contribute to structural stability in the specific cellular environment of this ancient plant lineage.

  • What are the optimal storage and handling conditions for recombinant Huperzia lucidula atpF protein?

    For optimal stability, store recombinant Huperzia lucidula atpF at -20°C for regular use or -80°C for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for stability . To minimize protein degradation, avoid repeated freeze-thaw cycles. Instead, prepare small working aliquots and store them at 4°C for up to one week. When reconstituting lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 25-50% is recommended to prevent freeze-damage to the protein structure.

Advanced Research Questions

  • How can phosphorylation affect the function of ATP synthase subunit b, and what experimental approaches are most effective for studying this in Huperzia lucidula?

    Phosphorylation of ATP synthase subunits can significantly alter both structure and function of the complex. Based on studies of homologous sites in yeast F1Fo ATP synthase β subunit, phosphorylation at specific residues (particularly those homologous to T58, T262, and T318 in yeast) can affect complex assembly, stability, and enzymatic activity .

    For Huperzia lucidula atpF, effective experimental approaches include:

    • Site-directed mutagenesis: Create phospho-mimetic (S/T→E) and non-phosphorylatable (S/T→A) variants at predicted phosphorylation sites

    • In vitro kinase assays: Identify which kinases phosphorylate specific residues

    • Mass spectrometry: Map actual phosphorylation sites in vivo and in vitro

    • Functional reconstitution: Incorporate wild-type and mutant proteins into liposomes to measure proton transport

    Data from yeast studies show dramatic effects on ATPase activity when phosphorylation sites are modified:

    MutationATPase Activity (μmoles Pi/mg/min)Effect on Complex
    Wild-type3.12±0.46Normal assembly
    T58A3.72±0.67Reduced dimerization
    T58E1.41±0.40Significantly reduced dimerization
    T262A4.01±0.36Normal assembly with increased activity
    T262ENo detectable activityAssembly defect/instability
    T318A0.17±0.15Reduced activity
    T318ENo detectable activityComplex structural changes

    These findings suggest that phosphorylation can serve as a regulatory mechanism for ATP synthase activity in vivo .

  • What are the evolutionary implications of studying Huperzia lucidula atpF in the context of chloroplast genome evolution?

    Huperzia lucidula was the first lycophyte to have its complete chloroplast genome sequenced, providing crucial insights into early vascular plant evolution . The atpF gene is particularly informative for several reasons:

    1. Lycophytes represent an early diverging lineage of vascular plants, separated from the ancestor of other vascular plants approximately 400 million years ago

    2. Comparative analysis between H. lucidula and other Huperzia species (like H. serrata) reveals patterns of chloroplast gene evolution within the genus

    3. The atpF gene shows selective conservation of functional domains across evolutionary time

    Methodologically, researchers should:

    • Perform phylogenetic analyses using concatenated chloroplast genes including atpF

    • Analyze selection pressures (dN/dS ratios) on atpF compared to other chloroplast genes

    • Conduct sliding window analysis of genetic diversity (π) across the chloroplast genome to identify conserved vs. variable regions

    This approach has revealed that atpF exists within regions showing moderate conservation across Huperzia species, with π values typically between 0.01-0.03 in 600bp windows .

  • How can recombinant Huperzia lucidula atpF be effectively used in structural biology studies of the complete ATP synthase complex?

    Structural biology studies of ATP synthase using recombinant Huperzia lucidula atpF requires an integrated methodological approach:

    1. Protein production optimization: Express the protein in E. coli with appropriate tags (His-tag is commonly used) for purification

    2. Co-expression systems: Develop systems to co-express multiple ATP synthase subunits to promote proper complex assembly

    3. Cryo-EM sample preparation: Use techniques like GraFix (gradient fixation) to stabilize the ATP synthase complex

    4. Cross-linking mass spectrometry: Apply chemical cross-linking followed by MS analysis to map interaction surfaces

    5. Single-particle cryo-EM: Collect high-resolution images of the complex in different conformational states

    Recent technical advances in single-particle cryo-EM have made it possible to resolve ATP synthase structures at near-atomic resolution (3-4 Å). This approach is particularly valuable for Huperzia lucidula ATP synthase as it represents an evolutionarily distinct form of the complex compared to well-studied models from mammals, yeast, or bacteria.

Methodological Considerations

  • What are the most effective expression systems for producing functional recombinant Huperzia lucidula atpF?

    Several expression systems can be used, each with specific advantages:

    Expression SystemAdvantagesDisadvantagesYield (mg/L culture)
    E. coli (BL21)Fast growth, high yield, economicalLacks chloroplast-specific chaperones10-15
    E. coli (Rosetta)Optimized for rare codons in plant genesMay form inclusion bodies8-12
    Yeast (P. pastoris)Post-translational modifications, secretionLonger production time5-10
    Plant cell culturesNative-like folding environmentLow yields, expensive0.5-2

    For optimal results with E. coli expression:

    1. Use a construct with an N-terminal His-tag for purification

    2. Express at lower temperatures (16-20°C) to improve folding

    3. Add 0.1-0.5% Triton X-100 during lysis to aid solubilization

    4. Include 10-20% glycerol in purification buffers to maintain stability

    5. Consider fusion partners like SUMO or MBP if solubility is problematic

    Functional validation through ATP synthesis assays or reconstitution into liposomes should follow purification to ensure the recombinant protein retains native-like activity.

  • How can comparative analysis between Huperzia lucidula atpF and other species inform structure-function relationships?

    Comparative analysis requires a systematic approach:

    1. Multiple sequence alignment: Align atpF sequences from diverse plant lineages (lycophytes, ferns, gymnosperms, angiosperms)

    2. Conserved domain identification: Map highly conserved regions likely essential for function

    3. 3D structural modeling: Generate homology models based on resolved structures from other species

    4. Molecular dynamics simulations: Assess the stability of specific residues and their interactions

    5. Experimental validation: Test predictions through site-directed mutagenesis of conserved vs. variable residues

    This approach has identified several key features of Huperzia lucidula atpF:

    • A highly conserved transmembrane domain (residues 18-40)

    • A variable N-terminal region that may interact with species-specific partners

    • Conserved charged residues that are critical for proton translocation

    Cross-species comparisons provide natural experiments in protein evolution that highlight which structural elements are indispensable versus those that can vary while maintaining function.

  • What approaches can be used to study the integration of Huperzia lucidula atpF into the complete ATP synthase complex?

    Studying subunit integration requires techniques that preserve native interactions:

    1. Blue Native PAGE: Visualize intact ATP synthase complexes and subcomplexes

    2. Pull-down assays: Use tagged atpF to identify interaction partners

    3. Surface plasmon resonance: Quantify binding kinetics between atpF and other subunits

    4. In vivo protein complementation: Systems like split-GFP to verify interactions in living cells

    5. Hydrogen-deuterium exchange mass spectrometry: Map interaction surfaces and conformational changes

    When applying these methods to Huperzia lucidula atpF, researchers should be mindful that the protein may have evolved specific interaction patterns that differ from model organisms. Controls using ATP synthase subunits from well-characterized species are recommended to validate experimental approaches.

Troubleshooting and Data Analysis

  • What are common challenges in functional studies of recombinant Huperzia lucidula atpF and how can they be addressed?

    Several technical challenges may arise when working with this protein:

    ChallengeCauseSolution
    Low expression yieldCodon bias, toxicityOptimize codons, use specialized strains (C41/C43), reduce induction temperature
    Protein insolubilityHydrophobic domainsAdd detergents (DDM, LDAO), use fusion partners
    Loss of functionImproper foldingCo-express with chaperones, use mild solubilization conditions
    AggregationInstability in solutionInclude stabilizing agents (glycerol, trehalose)
    DegradationProtease sensitivityAdd protease inhibitors, identify and modify protease-sensitive sites

    For functional reconstitution studies:

    1. Use gentle detergents like DDM (n-Dodecyl β-D-maltoside) at 0.05-0.1% for extraction

    2. Reconstitute into liposomes with plant lipid composition (MGDG, DGDG, SQDG, PG)

    3. Verify orientation using protease protection assays

    4. Measure proton transport using pH-sensitive dyes (ACMA, pyranine)

  • How should researchers interpret data from mutagenesis studies of Huperzia lucidula atpF?

    When analyzing mutagenesis data:

    1. Distinguish direct vs. indirect effects: Changes in ATP synthase activity may result from direct functional alterations or indirect effects on complex assembly

    2. Consider structural context: Interpret the impact of mutations based on their location within predicted structural elements (transmembrane regions, interaction surfaces)

    3. Compare with homologous mutations: Reference studies in model organisms for context (e.g., yeast mutations at T262 abolish activity)

    4. Examine multiple parameters: Assess changes in expression level, complex assembly, ATP synthesis rates, and proton transport

    5. Analyze dose-dependency: Test a range of mutation effects using different amino acid substitutions at key sites

    Data from yeast studies show that phospho-mimetic mutations can have distinct effects:

    • Some primarily affect complex assembly (T262E)

    • Others mainly impact enzymatic activity without disrupting assembly (T318E)

    • Some affect supercomplex formation or dimerization (T58E)

    Similarly detailed analysis should be applied to Huperzia lucidula atpF mutations.

  • What bioinformatic approaches are most valuable for analyzing Huperzia lucidula atpF in the context of chloroplast genome evolution?

    Effective bioinformatic analysis should include:

    1. Selective pressure analysis: Calculate dN/dS ratios to identify sites under positive, neutral, or purifying selection

    2. Ancestral sequence reconstruction: Infer ancestral states to track evolutionary changes

    3. Coevolution analysis: Identify co-evolving residues within atpF or between atpF and other ATP synthase subunits

    4. Sliding window analysis: Compare nucleotide diversity (π) across atpF and other chloroplast genes

    5. Structural impact prediction: Map sequence variations onto 3D structural models to assess functional implications

    For comparative genomics, the following approach is recommended:

    • Align complete chloroplast genomes of multiple Huperzia species

    • Identify syntenic regions and rearrangements

    • Calculate nucleotide diversity across different functional regions

    • Identify highly conserved vs. variable domains within atpF

    Studies comparing Huperzia lucidula with H. serrata have revealed regions of high genetic diversity (π > 0.05) and identified insertion/deletion polymorphisms that may affect protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.