Recombinant Huperzia lucidula Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Huperzia lucidula Cytochrome b6-f complex subunit 4 (petD) is a protein component of the cytochrome b6-f complex found in Huperzia lucidula, also known as shining clubmoss . Cytochrome b6-f complex subunit 4, or petD, is a subunit of the cytochrome b6-f complex, an enzyme that is essential for photosynthetic electron transfer in plants and cyanobacteria . The petD subunit is encoded by the petD gene . It is also known by other names, such as Cytochrome b6-f complex subunit 4 and 17 kDa polypeptide .

Protein Properties

PropertyDescription
SpeciesHuperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
SourceE. coli
TagHis
Protein LengthFull Length (1-160 aa)
FormLyophilized powder
Amino Acid SequenceMGVAKKPDLSDPVSRAKLAKGMGHNYYGEPAWPNDLLYIPPVVIPGTIACTVGLAVLEPSMIGEPANPFATPLEILPEWYFSPVFQILRTVPNKLLGVLLMAAVPAGLLVVPFPENVNKFQNPFRRPVATTVFSAGTAVAPWLGIGAALPIDKSLTLGLF
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge the vial before opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Default final concentration of glycerol is 50%. Customers could use it as a reference .
Gene NamepetD
SynonymspetD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
UniProt IDQ5SD24

Function

The cytochrome b6-f complex, which includes the petD subunit, mediates state transitions by controlling the antenna sizes of photosystems I and II . These transitions are triggered by reversible phosphorylation of light-harvesting complexes II, and they rely on the redox state of the plastoquinone pool . The cyt b6-f activates the Stt7 kinase when the plastoquinone pool is reduced, though the precise mechanism is not fully understood . Mutagenesis studies of the chloroplast petD gene have revealed that specific residues in subunit IV of the cyt b6-f complex are essential for state transitions .

Research Findings

Research has shown that particular residues, such as Asn122, Tyr124, and Arg125, located in the stromal loop connecting helices F and G of cyt b6-f subunit IV, are critical for state transitions . Cyt b6-f enhances Stt7 autophosphorylation, and the Arg125 residue is directly involved in this process, as demonstrated by in vitro reconstitution experiments using purified cyt b6-f and the recombinant Stt7 kinase domain . These findings indicate a direct interaction with Stt7 on the stromal side of the membrane and provide evidence of the peripheral stromal structure of the cyt b6-f complex, which had no previously known function .

Related proteins

Cat.No.SpeciesUniProt ID
RFL29988EFE. coliQ4G3F7
RFL141CFChaetosphaeridium globosumQ8M9Z5

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
petD
Target Protein Sequence
MGVAKKPDLSDPVSRAKLAKGMGHNYYGEPAWPNDLLYIPPVVIPGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFSPVFQILRTVPNKLLGVLLMAAVPAGLLVVPFPENVNKF QNPFRRPVATTVFSAGTAVAPWLGIGAALPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD gene play?

The cytochrome b6-f complex is a crucial membrane protein complex that mediates electron transfer between photosystem II and photosystem I in the photosynthetic electron transport chain. The petD gene specifically encodes subunit IV of this complex, which contains multiple transmembrane helices (including helices E, F, and G) and connecting loops that are critical for the complex's structure and function . Subunit IV plays important roles in:

  • Maintaining structural integrity of the cytochrome b6-f complex

  • Contributing to the quinol oxidation site

  • Facilitating proper electron transfer pathways

  • Supporting state transitions during photosynthesis

  • Ensuring efficient linear electron flow

In Huperzia lucidula, as with other photosynthetic organisms, the petD gene is located in the chloroplast genome and exhibits conserved structural features with species-specific variations that may influence its functional properties .

Why is Huperzia lucidula of particular interest for petD research?

Huperzia lucidula (Shining Clubmoss) has gained significant research attention for several reasons:

  • It belongs to an ancient lineage of vascular plants (Lycopodiaceae), providing evolutionary insights into the development of photosynthetic machinery

  • It produces bioactive compounds of medicinal importance, particularly Huperzine A, which has been found effective in treating Alzheimer's disease

  • Its endophytes (symbiotic bacteria or fungi) can also produce valuable secondary metabolites

  • Its chloroplast genome contains distinctive features compared to those of other plant groups

  • Studying its photosynthetic proteins may reveal adaptations specific to its ecological niche

The petD gene from H. lucidula represents an opportunity to understand both the fundamental aspects of photosynthesis and potential biotechnological applications related to this medicinal plant.

What are the basic structural features of H. lucidula petD?

The petD gene in H. lucidula encodes subunit IV of the cytochrome b6-f complex, characterized by:

  • Multiple transmembrane helices, including the conserved helices E, F, and G

  • A distinctive stromal loop connecting helices F and G (fg loop) that appears crucial for function

  • The PEWY motif, which is highly conserved and essential for quinol oxidation

  • C-terminal region that contributes to proper folding and assembly

  • Sequence elements that differ from those of other plant species, reflecting its evolutionary history

The fg loop in particular has been identified as functionally important based on mutagenesis studies in model organisms, with mutations in this region affecting photosynthetic performance while maintaining protein stability .

What are the optimal expression systems for producing recombinant H. lucidula petD protein?

For successful expression of recombinant H. lucidula petD, researchers should consider:

Chloroplast Transformation Systems:

  • Chlamydomonas reinhardtii: The most established algal system for chloroplast transformation, allowing homologous recombination into the chloroplast genome

  • Nicotiana tabacum: Plant-based chloroplast transformation system that may provide appropriate post-translational modifications

  • E. coli-based expression: Can be used for initial construct validation, though may lack necessary factors for proper folding

Key Methodological Considerations:

  • Codon optimization based on the expression host

  • Addition of affinity tags (His-tag commonly used for cytochrome b6-f subunits)

  • Inclusion of appropriate chloroplast targeting sequences when using nuclear transformation

  • Selection of antibiotic resistance markers compatible with the host organism

  • Verification of integration using PCR and sequencing

When using the C. reinhardtii system, researchers have successfully complemented ΔpetD strains with variant petD genes, demonstrating the feasibility of heterologous expression for functional studies .

How do mutations in the stromal fg loop of petD affect photosynthetic function?

Mutagenesis studies targeting the fg loop of petD have revealed critical insights applicable to H. lucidula research:

Mutation RegionPhotosystem II Efficiency (Fv/Fm)Photochemical Quenching (qP)State Transitions (qT)Photoautotrophic Growth
Wild-type≥0.7≥0.8≥0.4Normal
ΔpetD≥0.7<0.05<0.05None
fg loop mutations≥0.7≥0.8<0.05Normal

This pattern indicates that mutations in the fg loop specifically impair state transitions (the ability to redistribute excitation energy between photosystems) while maintaining linear electron flow . The significance for H. lucidula research includes:

  • The fg loop (residues approximately 118-125) appears critical for interactions with regulatory proteins

  • Mutations in this region create a specific phenotype where electron transport remains functional but dynamic responses are impaired

  • The loop likely serves as an interaction site for regulatory kinases such as Stt7/STN7

  • Conservation of this region across species suggests its fundamental importance in photosynthetic regulation

Research approaches incorporating both random and site-directed mutagenesis have proven valuable in elucidating these structure-function relationships .

What techniques are most effective for analyzing interactions between recombinant petD and other photosynthetic proteins?

To study the interactions of recombinant H. lucidula petD with other components of the photosynthetic apparatus, researchers can employ:

In Vitro Techniques:

  • Co-immunoprecipitation using antibodies against tagged petD or interacting partners

  • Surface plasmon resonance to measure binding kinetics

  • Isothermal titration calorimetry for thermodynamic characterization

  • Chemical cross-linking followed by mass spectrometry to identify interaction sites

  • Yeast two-hybrid assays for initial screening of interaction partners

In Vivo Approaches:

  • Bimolecular fluorescence complementation in plant or algal systems

  • Förster resonance energy transfer (FRET) between fluorescently tagged proteins

  • In vivo cross-linking followed by co-purification

  • Genetic complementation studies using deletion mutants

  • Conditional expression systems to study temporal aspects of interactions

These techniques can specifically address interactions with state transition kinases like Stt7/STN7, which have been implicated in binding to the stromal fg loop of petD based on mutagenesis studies .

How should researchers design a random mutagenesis study of H. lucidula petD?

A comprehensive random mutagenesis approach for H. lucidula petD should include:

Mutagenesis Strategy:

  • Target specific functional regions (e.g., from the PEWY motif through helices F and G)

  • Employ error-prone PCR with controlled mutation rates

  • Create a library of variants in appropriate vectors for chloroplast transformation

  • Transform a host organism lacking endogenous petD (ΔpetD strain)

  • Screen transformants under selective conditions (e.g., photoautotrophic growth)

Functional Assessment Protocol:

This approach has successfully identified functional domains in cytochrome b6-f subunits, revealing that mutations in the stromal fg loop specifically impair state transitions while maintaining other photosynthetic functions .

What are the key considerations for analyzing the chloroplast genome context of petD in Huperzia species?

When analyzing the chloroplast genome context of petD in Huperzia species, researchers should consider:

Genomic Analysis Framework:

  • Complete chloroplast genome sequencing using next-generation sequencing platforms

  • Genome assembly and annotation with specialized tools for organellar genomes

  • Comparative analysis with related species (e.g., H. serrata, which has a chloroplast genome of 154,176 bp with 36.3% GC content)

  • Identification of conserved and variable regions surrounding petD

  • Analysis of RNA editing sites that may alter the protein sequence from the genomic sequence

Specific Analytical Focus:

  • Gene order and synteny around petD

  • Presence and structure of introns (petD often contains introns in land plants)

  • Assessment of selective pressures using dN/dS ratios

  • Identification of SNPs and indels between Huperzia species

  • Analysis of promoter regions and transcriptional regulatory elements

Comparative studies between H. lucidula and H. serrata have revealed 252 mutation events including 27 insertion/deletion polymorphisms and 225 SNPs across their chloroplast genomes, providing context for understanding petD evolution in this genus .

What techniques can be used to assess the presence and characteristics of petD in endophytes of H. lucidula?

To investigate petD in potential endophytes of H. lucidula:

Isolation and Screening Protocol:

  • Surface sterilization of plant material to remove epiphytic microorganisms

  • Plating homogenized tissue on selective media to isolate endophytic bacteria and fungi

  • DNA extraction from isolated colonies

  • PCR-based screening using degenerate primers targeting conserved regions of petD

  • Sequencing of amplicons to confirm identity and characterize variations

Advanced Characterization Methods:

  • Whole genome sequencing of promising isolates

  • Transcriptomic analysis to assess petD expression under different conditions

  • Metabolomic screening to correlate petD variants with secondary metabolite production

  • Phylogenetic analysis to determine evolutionary relationships

  • Functional complementation studies in model organisms

This approach aligns with methods used to characterize over 270 endophytes isolated from H. lucidula, which were subsequently narrowed down based on metabolite analysis .

How can researchers effectively identify and validate novel SNPs in the petD gene of H. lucidula?

For identification and validation of novel SNPs in H. lucidula petD:

SNP Discovery Pipeline:

  • Obtain high-quality DNA from multiple H. lucidula samples representing different populations or accessions

  • Amplify the petD region using high-fidelity polymerase

  • Employ next-generation sequencing with sufficient depth (>30x coverage)

  • Use multiple bioinformatic tools for SNP calling (e.g., custom Python scripts based on single-nucleotide variation at specific positions)

  • Filter candidate SNPs based on quality scores and coverage depth

Validation Strategy:

  • Design PCR-RFLP assays for selected SNPs

  • Perform Sanger sequencing on representative samples

  • Assess population frequency using high-resolution melting analysis

  • Evaluate functional significance through heterologous expression

  • Correlate SNPs with phenotypic variations if applicable

This approach is consistent with methods used to identify genetic diversity in Huperzia species, where sliding window analysis (window length 600 bp, step size 200 bp) has been effective in identifying variable regions .

What are the best approaches for analyzing post-translational modifications of recombinant H. lucidula petD?

To characterize post-translational modifications (PTMs) of recombinant H. lucidula petD:

Analytical Workflow:

  • Express and purify recombinant petD with appropriate affinity tags

  • Perform proteolytic digestion with multiple proteases to ensure complete coverage

  • Analyze peptides using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

  • Employ both collision-induced dissociation (CID) and electron transfer dissociation (ETD) fragmentation methods

  • Process data with specialized PTM detection algorithms

Targeted PTM Investigations:

  • Phosphorylation analysis using phospho-enrichment techniques (particularly relevant for state transition regulation)

  • Redox modification assessment using differential alkylation approaches

  • Membrane protein-specific modifications (e.g., lipid attachments) using specialized extraction methods

  • Cross-validation of identified PTMs using site-directed mutagenesis

  • Comparison of PTM patterns under different physiological conditions

This comprehensive approach enables researchers to understand how post-translational regulation affects the function of petD in photosynthetic processes, particularly in relation to environmental responses and state transitions.

How can researchers address the challenges of expressing membrane proteins like petD in heterologous systems?

Membrane proteins like petD present specific challenges for recombinant expression:

Technical Solutions:

  • Selection of expression hosts with appropriate membrane compositions

  • Use of fusion partners that enhance membrane targeting and folding

  • Optimization of growth temperature and induction conditions

  • Supplementation with specific lipids or detergents during expression

  • Employment of specialized extraction and purification protocols

For H. lucidula petD specifically, chloroplast transformation systems provide advantages by offering the native environment for protein folding and assembly. Complementation of ΔpetD host strains with H. lucidula variants allows functional assessment in vivo before attempting purification .

What are the emerging techniques for studying the relationship between petD variants and medicinal compound production in Huperzia species?

To investigate connections between petD and medicinal compound production:

Integrated Research Approaches:

  • CRISPR-based editing of chloroplast genomes to create specific petD variants

  • Metabolomic profiling to correlate petD variations with secondary metabolite production

  • Stable isotope labeling to track carbon flux through photosynthesis into specialized metabolites

  • Transcriptome analysis to identify co-regulated pathways

  • Heterologous expression of complete biosynthetic pathways in model organisms

Huperzia species produce valuable compounds like Huperzine A, which inhibits acetylcholinesterase and has applications in treating Alzheimer's disease . Understanding how photosynthetic efficiency influenced by petD variants affects secondary metabolism could provide insights for optimizing medicinal compound production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.