Recombinant Huperzia lucidula Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Huperzia lucidula Cytochrome b6 (petB) is a full-length, His-tagged protein (UniProt ID: Q5SD23) expressed in E. coli . Key production details include:

  • Expression System: E. coli

  • Tag: N-terminal His tag (type determined during production)

  • Sequence Length: 215 amino acids

  • Purity: >90% (verified by SDS-PAGE)

Genomic and Evolutionary Context

The petB gene resides in the plastid genome of H. lucidula, which spans 154,373 bp with 124 genes . Comparative plastid genomics reveals:

Table 2: Plastid Genome Features of Huperzia Species

SpeciesGenome Size (bp)LSC (bp)SSC (bp)IRs (bp)GC Content
H. lucidula154,373104,08819,65715,31436.25%
H. serrata154,176104,08019,65815,21936.28%
  • Conservation: petB is retained across lycophytes, with sequence homology to Selaginella and Isoetes species .

  • Inversion Events: A 30-kb inversion distinguishes H. lucidula plastomes from bryophytes and seed plants .

A. Mutational Studies

  • Proline-to-leucine substitutions at position 204 in petB (mimicking RNA editing in maize/tobacco) disrupt Cyt b6f assembly, confirming PetB’s role in complex stability .

  • Knockout mutants of petB homologs in tobacco result in photoautotrophic failure due to destabilized Cyt b6f subunits .

B. Electron Transport Analysis

  • Recombinant PetB enables in vitro assays to study plastoquinol oxidation and cyclic electron flow .

  • Light Sensitivity: ΔpetL mutants (lacking a Cyt b6f subunit) show reduced PSII phosphorylation under high light, highlighting PetB’s regulatory role .

Comparative Insights

  • Algal vs. Plant Systems: In Chlamydomonas, petB mutations block electron transport, whereas tobacco mutants retain partial function, suggesting divergent assembly mechanisms .

  • Industrial Relevance: Recombinant PetB is used for antibody production, structural modeling, and photosynthesis optimization studies .

Technical Considerations

  • Storage: Lyophilized powder in Tris/PBS buffer with 50% glycerol .

  • Applications: SDS-PAGE, ELISAs, and functional assays requiring high-purity Cyt b6f components .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSSPWDQIGYWAVKIVTGVPEAIPVVGSPLVELSRGSVSVGQSTL TRFYSLHTFVSPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what role does it play in photosynthesis?

Cytochrome b6, encoded by the petB gene, is a critical subunit of the cytochrome b6f complex (Cyt b6f) that plays pivotal roles in both linear and cyclic electron transport pathways during oxygenic photosynthesis in plants and cyanobacteria . The cytochrome b6f complex serves as an essential intermediary component, facilitating electron transfer between photosystem II and photosystem I. This process is fundamental to converting light energy into chemical energy and maintaining proper redox balance within photosynthetic organisms.

The protein contains multiple transmembrane helices that anchor it within the thylakoid membrane, where it functions as part of the electron transport chain. In Huperzia lucidula, as in other photosynthetic organisms, this protein maintains a highly conserved structure with specific binding sites for heme groups that facilitate electron transfer through the complex .

How is RNA editing involved in Cytochrome b6 expression in Huperzia lucidula?

RNA editing plays a crucial role in the post-transcriptional modification of chloroplast transcripts in lycophytes, including Huperzia lucidula. This process involves specific nucleotide conversions in transcripts that can alter the amino acid sequence of the resulting protein. In lycophytes, both C-to-U and U-to-C editing events occur, although U-to-C editing is less common and confined to hornworts, lycophytes, and ferns .

For Cytochrome b6 (petB) specifically, RNA editing ensures the correct translation of the protein by modifying codons that would otherwise result in amino acids incompatible with proper protein function. These editing events are particularly important for maintaining the highly conserved functional domains necessary for electron transport activity.

RNA editing is mediated by pentatricopeptide repeat (PPR) proteins that recognize specific RNA sequences. Notably, the DYW and DYW:KP subfamilies of PPR proteins have been implicated in the editing process, with specific factors predicted to target the petB transcript . The distribution and patterns of RNA editing sites within petB can provide valuable insights into the evolutionary history and functional constraints of Cytochrome b6 across different plant lineages.

How can recombinant Huperzia lucidula Cytochrome b6 be used to study state transitions in photosynthetic organisms?

Recombinant Huperzia lucidula Cytochrome b6 provides a valuable tool for investigating state transitions, which are regulatory mechanisms that balance excitation energy between photosystems I and II. Recent research has demonstrated that the cytochrome b6f complex is required for state transitions in cyanobacteria, as evidenced by the abolishment of state transitions in ΔpetN mutants where the Cyt b6f complex is destabilized .

When using recombinant Cytochrome b6, researchers can conduct reconstitution experiments to assess its role in different aspects of electron transport and state transitions. Methodologically, this involves:

  • Purifying the recombinant protein under non-denaturing conditions to maintain structural integrity

  • Incorporating it into artificial membrane systems or depleted thylakoid preparations

  • Measuring electron transport rates using artificial electron acceptors such as N,N,N',N'-tetramethyl-p-phenylenediamine (TMPD)

  • Monitoring state transitions through 77K fluorescence spectroscopy or room temperature fluorescence kinetics

What experimental approaches can determine the interaction between Cytochrome b6 and other components of the photosynthetic electron transport chain?

Investigating interactions between Cytochrome b6 and other photosynthetic components requires multiple complementary approaches:

  • Co-immunoprecipitation assays: Using antibodies against recombinant His-tagged Cytochrome b6 to pull down interaction partners from thylakoid membrane preparations.

  • Crosslinking studies: Employing chemical crosslinkers of varying lengths to capture transient interactions between Cytochrome b6 and components like plastocyanin, ferredoxin, or photosystem subunits.

  • Surface plasmon resonance (SPR): Measuring binding kinetics between immobilized recombinant Cytochrome b6 and potential interaction partners in real-time.

  • Fluorescence resonance energy transfer (FRET): Tagging Cytochrome b6 and potential interacting proteins with fluorescent labels to detect proximity-dependent energy transfer.

  • Electron transport assays: Measuring electron flow using specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone, which targets the Cyt b6f complex, to determine functional interactions .

These techniques can reveal both structural associations and functional dependencies between Cytochrome b6 and other components of the electron transport chain. Notably, recent research has highlighted the importance of small subunits in stabilizing the entire cytochrome b6f complex, suggesting that protein-protein interactions play crucial roles in maintaining the structural integrity necessary for electron transport .

How does the loss of specific Cytochrome b6f subunits affect photosynthetic efficiency in model organisms?

Studies on cyanobacterial mutants provide valuable insights into the functional consequences of cytochrome b6f subunit loss. In a petN mutant (ΔpetN) of Anabaena variabilis, the loss of PetN, one of the small subunits unique to oxygenic photosynthesis, resulted in destabilization of the entire Cyt b6f complex . This led to significant reductions in the large subunits of Cyt b6f (including Cytochrome b6), which decreased to 20%-25% of wild-type levels.

The functional consequences were substantial:

ParameterWild TypeΔpetN Mutant% of Wild Type
Oxygen evolution activityNormalReduced~30%
Linear electron transferNormalPartially inhibitor-insensitive-
Cyclic electron transferNormalPartially inhibitor-insensitive-
State transitionsPresentAbolished0%
PSII/PSI ratioLowerHigher-

Notably, the oxygen evolution activity in the mutant could be largely restored by adding N,N,N',N'-tetramethyl-p-phenylenediamine (TMPD), which functions as an electron carrier and bypasses the Cyt b6f complex . This demonstrates that the primary defect was in electron transport through the Cyt b6f complex rather than in other photosynthetic components.

These findings can inform research using recombinant Huperzia lucidula Cytochrome b6 by highlighting the importance of studying not just the isolated protein but also its interactions with other subunits and complexes in the photosynthetic apparatus.

What are the optimal conditions for storing and handling recombinant Huperzia lucidula Cytochrome b6?

Proper storage and handling of recombinant Cytochrome b6 is critical for maintaining its structural integrity and functional activity. Based on established protocols for similar recombinant proteins, the following guidelines are recommended:

  • Storage temperature: Store at -20°C for routine use, or at -80°C for extended storage periods .

  • Buffer composition: Maintain in Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Aliquoting: Divide into small working aliquots before freezing to avoid repeated freeze-thaw cycles, which can cause protein denaturation .

  • Working conditions: When actively using the protein, store working aliquots at 4°C for up to one week .

  • Reconstitution: For lyophilized preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 5-50% before aliquoting and storing .

These conditions minimize protein degradation while preserving functional activity. It's particularly important to avoid repeated freeze-thaw cycles, as membrane proteins like Cytochrome b6 are especially susceptible to denaturation due to their hydrophobic domains .

What expression systems are most effective for producing functional recombinant Huperzia lucidula Cytochrome b6?

Producing functional recombinant Cytochrome b6 presents unique challenges due to its membrane-associated nature and the requirement for proper cofactor incorporation. Several expression systems have been evaluated:

  • E. coli-based expression: The most commonly used system due to its simplicity and cost-effectiveness. For optimal results with membrane proteins like Cytochrome b6, specialized strains such as C41(DE3) or C43(DE3) are recommended, along with reduced induction temperatures (16-20°C) to prevent inclusion body formation .

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris provide eukaryotic processing capabilities with relatively high yields. These systems are particularly advantageous when post-translational modifications are critical.

  • Cell-free expression systems: These can be advantageous for membrane proteins, allowing direct incorporation into artificial liposomes or nanodiscs during synthesis.

For any expression system, incorporation of the heme cofactor is essential for functional activity. This can be achieved by supplementing the growth medium with δ-aminolevulinic acid, a heme precursor, or by co-expressing proteins involved in heme biosynthesis.

Purification typically employs affinity chromatography using His-tags or other fusion tags, followed by size exclusion chromatography to obtain homogeneous preparations . Detergent selection is critical during purification, with mild detergents like n-dodecyl-β-D-maltoside (DDM) often providing the best balance between effective solubilization and maintenance of protein structure.

How can researchers verify the functional activity of recombinant Cytochrome b6 after purification?

Confirming the functional integrity of purified recombinant Cytochrome b6 requires multiple complementary assays:

  • Spectroscopic analysis: UV-visible spectroscopy can verify proper heme incorporation by examining characteristic absorption peaks at approximately 414 nm (Soret band) and 563 nm (α-band) for reduced cytochrome b6. The ratio between these peaks provides information about the protein's redox state and structural integrity.

  • Redox potential measurements: Determining the midpoint redox potential using techniques such as potentiometric titration confirms the protein's electron transfer capabilities.

  • Electron transfer assays: Measuring the protein's ability to transfer electrons between artificial donors and acceptors, such as decylplastoquinone and ferricyanide, provides functional validation.

  • Reconstitution experiments: Incorporating the purified protein into liposomes or depleted thylakoid membranes and measuring restoration of electron transport activity provides the most definitive functional assessment.

  • Inhibitor sensitivity: Testing sensitivity to known cytochrome b6f inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone can confirm specific activity .

These assays collectively provide a comprehensive assessment of the recombinant protein's structural integrity and functional capacity. Notably, functional assays are particularly important for membrane proteins like Cytochrome b6, where traditional structural assays may not fully capture the protein's native conformation and activity in a membrane environment.

What methodologies can be used to study RNA editing of the petB transcript in Huperzia lucidula?

Investigating RNA editing in the petB transcript requires specialized techniques to identify and characterize editing events:

  • RT-PCR and Sanger sequencing: Amplifying the petB transcript using reverse transcription PCR followed by Sanger sequencing allows direct comparison between genomic DNA and RNA sequences to identify editing sites.

  • High-throughput sequencing: RNA-Seq approaches provide comprehensive coverage of editing sites across the entire transcriptome, enabling identification of all editing events in the petB transcript simultaneously.

  • Poisoned primer extension: This technique can quantify the efficiency of editing at specific sites by using primers that terminate immediately before an editing site.

  • In vitro editing assays: Developing cell-free systems containing chloroplast extracts to test editing of synthetic petB RNA substrates can help identify the factors required for editing.

  • PPR protein binding assays: Identifying the specific pentatricopeptide repeat (PPR) proteins that recognize the petB transcript at editing sites using techniques like RNA electrophoretic mobility shift assays (REMSA) or RNA immunoprecipitation .

Analysis of RNA editing patterns in lycophytes like Phylloglossum drummondii has revealed that U-to-C RNA editing is rare in this group, with only four such sites identified in mitochondria and none in chloroplasts . This suggests that studies of petB editing in Huperzia lucidula should focus primarily on C-to-U editing events, which are more common in land plants.

How has the structure and function of Cytochrome b6 evolved among different plant lineages?

Cytochrome b6 demonstrates remarkable evolutionary conservation in its core functional domains while exhibiting lineage-specific adaptations. Comparative analysis reveals several key evolutionary patterns:

  • Core conservation: The four large subunits of the cytochrome b6f complex, including cytochrome b6 (petB), have clear homologs in the cytochrome bc1 complex of non-photosynthetic bacteria, indicating an ancient evolutionary origin .

  • Unique adaptations: The four small subunits of the cytochrome b6f complex, including PetN, are unique to oxygenic photosynthesis and represent adaptations specific to this photosynthetic mechanism .

  • RNA editing patterns: The distribution of RNA editing sites in the petB transcript varies substantially across plant lineages, with ferns showing high numbers of both C-to-U and U-to-C editing events, while lycophytes like Phylloglossum drummondii show a more restricted pattern with few U-to-C editing sites .

These evolutionary patterns can be visualized by comparing the protein sequences and editing sites across representative species from major plant lineages:

Plant GroupRepresentative SpeciespetB LengthNumber of C-to-U Editing SitesNumber of U-to-C Editing SitesDistinctive Features
LycophytesHuperzia lucidula215 aaMultipleFew or noneAncient lineage with distinctive RNA editing patterns
FernsAzolla speciesVariableHighHighComplex editome with both types of editing events
GymnospermsVarious conifersVariableMultipleNoneC-to-U editing predominates
AngiospermsVarious flowering plantsVariableFewNoneReduced RNA editing compared to earlier-diverging lineages

This evolutionary perspective provides valuable context for understanding the significance of specific structural features and modifications in Huperzia lucidula Cytochrome b6.

How do mutations in Cytochrome b6 affect photosynthetic efficiency across different environmental conditions?

The relationship between Cytochrome b6 mutations and photosynthetic efficiency is complex and environment-dependent. Research on cyanobacterial mutants provides insights applicable to studies with recombinant Huperzia lucidula Cytochrome b6:

  • Light intensity effects: Mutations affecting Cytochrome b6 or associated subunits can have differential impacts under varying light intensities. The destabilization of the cytochrome b6f complex in ΔpetN mutants results in a higher PSII/PSI ratio compared to wild type, suggesting compensatory adjustments in photosystem stoichiometry .

  • Electron transport limitations: Under normal light conditions, mutants with destabilized cytochrome b6f complexes show reduced oxygen evolution (approximately 30% of wild type), indicating significant limitations in the electron transport capacity .

  • Alternative electron pathways: The partial insensitivity of both linear and cyclic electron transfer to cytochrome b6f inhibitors in mutants suggests the activation of alternative electron transport pathways when the main pathway is compromised .

  • State transition impairments: Mutations affecting the cytochrome b6f complex abolish state transitions, preventing the organism from optimally balancing excitation energy between photosystems under fluctuating light conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.