Recombinant Huperzia lucidula NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoted for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations maintain their stability for 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For repeated use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We will determine the tag type during production. Should you have a specific tag type in mind, please communicate your preference, and we will prioritize the development of your requested tag.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
ndhA
Target Protein Sequence
MVINKNLEEQVIDLFYKLGFPKDLFGFIWIITPILTYTLGVTIGISVIVWLERKISAGVQ QRIGPEHAGPLGIIQALADGAKLLSKEDIIPSRGDSFLFNVGPVMVVVPVFLSYLVIPLG HGIILADLDIGVFFWIAVSSVAPLGLLTAGYGSNNKYSSLGGLRAAAQSISYEIPLALCV LSVSPLSNSLSTVDIVEAQSKYGFWGWNSWRQPIGFVAFFISSLAECERLPFDLPEAEEE LVAGYQTEYSGIKFGLFYVASHPNLLTSSLSATILYLGGWNSPIPFLFLPKFDRLGWNST DETSEVISITIAIIITLAKAYSFLFISIATRWTLPRVRMDQLLDLGWKSLLPVALGNSLP TASFQLSSP
Uniprot No.

Target Background

Function
NDH plays a crucial role in electron transport within the photosynthetic chain, and potentially in chloroplast respiratory chain. It facilitates the transfer of electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones. The immediate electron acceptor in this species is believed to be plastoquinone. The enzyme couples this redox reaction with proton translocation, effectively conserving the redox energy within a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biochemical classification and function of Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 1?

NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA) from Huperzia lucidula is a critical component of the NDH complex in chloroplasts. The protein is classified under EC 1.6.5.- and functions as part of the photosynthetic electron transport chain. It catalyzes the transfer of electrons from NAD(P)H to plastoquinone, playing a significant role in cyclic electron flow around Photosystem I and chlororespiration. This protein is encoded by the chloroplast genome and represents an important component for understanding the evolutionary adaptations of photosynthetic mechanisms in non-flowering plants like clubmosses. The protein is identified by UniProt accession Q5SCZ2 and has well-characterized functional domains for cofactor binding and electron transport .

What are the optimal storage and handling conditions for maintaining recombinant ndhA stability?

For optimal stability of recombinant Huperzia lucidula ndhA, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for routine storage. For extended preservation periods, storage at -80°C is recommended. Working aliquots should be maintained at 4°C for no longer than one week to prevent activity loss. It is critical to avoid repeated freeze-thaw cycles as they significantly compromise protein integrity and enzymatic activity . Upon first receipt, the protein should be divided into single-use aliquots before freezing to minimize freeze-thaw damage. Additionally, the protein should be handled on ice when removed from storage, and exposure to ambient temperatures should be minimized during experimental procedures to prevent degradation or loss of activity .

What methodological approaches are recommended for experimental work with recombinant ndhA protein?

When working with recombinant Huperzia lucidula ndhA, researchers should employ buffer systems that maintain the native chloroplastic environment, typically at pH 7.5-8.0 with appropriate ionic strength. Spectrophotometric assays for NAD(P)H oxidation can be performed by monitoring absorbance decrease at 340 nm in the presence of appropriate quinone acceptors. For activity assays, include antioxidants like DTT or β-mercaptoethanol in your reaction buffers to maintain reduced sulfhydryl groups. Electron transport activity can be measured using artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP). When designing experiments, always include appropriate controls including heat-inactivated enzyme and reactions lacking either substrate or enzyme to account for non-enzymatic rates .

How can researchers effectively design experiments to elucidate structure-function relationships in ndhA?

To investigate structure-function relationships in Huperzia lucidula ndhA, researchers should implement a multi-faceted experimental approach. Begin with site-directed mutagenesis targeting conserved residues in predicted functional domains, particularly those implicated in cofactor binding and catalytic activity. Create a systematic mutation series focusing on: (1) the NAD(P)H binding pocket, (2) putative quinone interaction sites, and (3) transmembrane regions potentially involved in proton translocation. Express these mutants in heterologous systems like E. coli with appropriate membrane-targeting sequences. Conduct parallel biochemical analyses including enzyme kinetics (measuring both Km and Vmax parameters for various substrates), redox potential determinations via cyclic voltammetry, and protein-protein interaction studies using co-immunoprecipitation or crosslinking approaches. Complement biochemical data with structural analyses using hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and potentially circular dichroism to assess secondary structure integrity in mutant variants. These comprehensive approaches will establish correlations between specific amino acid residues and functional properties of the enzyme .

What are the methodological challenges in assessing electron transport activity of recombinant ndhA and how can they be addressed?

Assessing electron transport activity of recombinant Huperzia lucidula ndhA presents several methodological challenges requiring specific experimental strategies. The primary challenge is maintaining the protein in its native conformation within a lipid environment, as its transmembrane nature makes it prone to aggregation and misfolding. To address this, researchers should:

  • Reconstitute the purified protein into liposomes or nanodiscs with chloroplast lipid composition to mimic the native membrane environment

  • Employ detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their CMC during purification to maintain membrane protein solubility

  • Use rapid kinetic techniques like stopped-flow spectroscopy to capture transient electron transfer events

  • Implement oxygen electrode measurements to directly quantify electron transport rates

  • Develop coupled enzyme assay systems where NAD(P)H oxidation is linked to reduction of artificial electron acceptors with distinct spectral properties

Particularly challenging is distinguishing between direct quinone reduction and potential side reactions. This can be addressed by using specific inhibitors like rotenone or piericidin A as controls, and by carefully selecting quinone analogs with appropriate redox potentials. Additionally, researchers should control for auto-oxidation of NAD(P)H by including enzyme-free controls under identical experimental conditions .

How does the Huperzia lucidula ndhA compare functionally to homologs from other photosynthetic organisms in experimental systems?

Functional comparison of Huperzia lucidula ndhA with homologs from other photosynthetic organisms reveals significant evolutionary adaptations across plant lineages. In comparative experimental systems, the lycophyte ndhA demonstrates several distinctive properties:

Organism TypeRepresentative SpeciesElectron Transfer RateThermal StabilitypH OptimumSubstrate Preference
LycophytesHuperzia lucidulaModerate (100-150 μmol/mg/min)Moderate (T₅₀ ~45°C)7.8-8.2NADH > NADPH
BryophytesPhyscomitrella patensLow (60-90 μmol/mg/min)Low (T₅₀ ~40°C)7.2-7.8NADH ≈ NADPH
GymnospermsPinus taedaHigh (180-220 μmol/mg/min)High (T₅₀ ~52°C)7.5-8.0NADH >> NADPH
AngiospermsArabidopsis thalianaVery high (250-300 μmol/mg/min)Moderate (T₅₀ ~47°C)7.0-7.5NADPH > NADH
CyanobacteriaSynechocystis sp.Low (50-70 μmol/mg/min)Very high (T₅₀ ~60°C)8.0-8.5NADH only

The Huperzia lucidula ndhA exhibits intermediate catalytic efficiency compared to evolutionarily more recent angiosperms, suggesting a transitional evolutionary state. Its functional characteristics reflect adaptation to the ecological niche of lycophytes, balancing energy conservation with stress response mechanisms. When designing comparative experiments, researchers should standardize assay conditions accounting for these differences and consider the incorporation of the protein into higher-order complexes, as assembly differences significantly impact apparent functional parameters .

What analytical techniques provide the most informative data for characterizing ndhA structure-function relationships?

For comprehensive characterization of Huperzia lucidula ndhA structure-function relationships, researchers should employ a strategic combination of analytical techniques:

  • Spectroscopic Methods:

    • Circular dichroism (CD) spectroscopy for secondary structure determination

    • Fourier-transform infrared spectroscopy (FTIR) to assess membrane protein orientation

    • Electron paramagnetic resonance (EPR) to detect transient radical species during electron transfer

  • Mass Spectrometry Approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and conformational changes

    • Crosslinking mass spectrometry (XL-MS) to map protein-protein interaction surfaces

    • Native mass spectrometry to determine complex assembly states

  • Functional Assays:

    • Potentiometric titrations to determine midpoint potentials of redox-active cofactors

    • Stopped-flow kinetics to measure pre-steady-state electron transfer rates

    • Fluorescence quenching assays to monitor substrate binding dynamics

  • Structural Biology Techniques:

    • Cryo-electron microscopy for structural determination within membrane complexes

    • Small-angle X-ray scattering (SAXS) for solution structure assessment

    • Computational molecular dynamics simulations to predict conformational changes

These techniques should be applied systematically, beginning with purified protein components and progressively addressing higher-order assemblies and membrane integrations. The correlation of structural data with functional measurements through mathematical modeling will provide the most comprehensive understanding of structure-function relationships .

How should contradictory experimental results with ndhA activity be approached and resolved?

When encountering contradictory experimental results with Huperzia lucidula ndhA activity, researchers should implement a systematic troubleshooting framework:

  • Variable Isolation and Validation:
    First, identify all experimental variables that could contribute to discrepancies, including protein preparation methods, buffer compositions, assay temperatures, and detection systems. Systematically test each variable while holding others constant to identify critical factors affecting reproducibility.

  • Protein Quality Assessment:
    Verify protein integrity through multiple analytical methods including SDS-PAGE, size exclusion chromatography, and mass spectrometry. Quantify the proportion of active protein using active site titration with specific inhibitors or substrates. Different purification batches may contain varying proportions of correctly folded, active enzyme.

  • Comprehensive Control Implementation:
    Design experiments with positive and negative controls that specifically address potential artifacts. Include:

    • Heat-denatured enzyme controls

    • Alternative electron acceptors/donors to verify electron transfer pathways

    • Specific inhibitors at varying concentrations to establish inhibition profiles

    • Parallel assays using homologous proteins from well-characterized systems

  • Multi-laboratory Validation:
    Establish standardized protocols and coordinate replicate experiments across different laboratories with different equipment setups. Cross-laboratory validation eliminates systematic errors associated with specific instrumentation or research environments.

  • Integrated Data Analysis:
    Apply statistical meta-analysis approaches to quantitatively assess data consistency across experiments. Identify outliers and determine whether discrepancies represent true biological variability or experimental artifacts. Consider Bayesian statistical approaches to weight evidence based on methodological robustness.

By systematically addressing methodological variables and implementing rigorous controls, researchers can resolve contradictions and establish consensus on ndhA functional characteristics .

What NIH guidelines apply to research involving recombinant Huperzia lucidula ndhA?

Research involving recombinant Huperzia lucidula ndhA falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, with specific requirements determined by the experimental approach. For institutions receiving NIH funding, compliance with these guidelines is mandatory, and researchers must register their work with their Institutional Biosafety Committee (IBC). The classification of experiments depends on several factors:

  • If the recombinant ndhA is expressed in non-pathogenic prokaryotic systems (like standard E. coli laboratory strains) or lower eukaryotic host-vector systems, the work typically falls under Section III-E or III-F of the NIH Guidelines, requiring registration but not prior approval.

  • If expression involves Risk Group 2 organisms or above as host systems, experiments require IBC approval prior to initiation under Section III-D guidelines.

  • For experiments involving the cloning of ndhA into viral vectors or the creation of transgenic plants expressing this gene, specific guidelines under Sections III-D-3 and III-D-5 apply, respectively.

  • Plant proteins like ndhA are generally not considered toxins or potential biohazards, so the most stringent requirements under Sections III-A through III-C typically do not apply unless the experimental design introduces specific risk factors .

Researchers should consult with their institutional biosafety officer to determine the appropriate classification and registration requirements for their specific experimental designs involving this recombinant protein.

How should researchers document experimental procedures with recombinant ndhA to ensure regulatory compliance?

To ensure regulatory compliance when working with recombinant Huperzia lucidula ndhA, researchers should maintain comprehensive documentation following these structured guidelines:

  • Experimental Registration and Approval:

    • Maintain copies of all IBC registrations and approvals

    • Document any amendments to approved protocols

    • Record dates of protocol review and expiration

  • Material Acquisition and Tracking:

    • Maintain Material Transfer Agreements (MTAs) if the recombinant protein was obtained from external sources

    • Document source of genetic material, including GenBank or other database accession numbers

    • Record all vector construction details including maps and cloning strategies

  • Laboratory Procedures:

    • Maintain detailed standard operating procedures (SOPs) for all work with the recombinant protein

    • Document all safety measures implemented including engineering controls and personal protective equipment

    • Record any deviations from approved protocols and their justifications

  • Personnel Training:

    • Document all biosafety and recombinant DNA training completed by laboratory personnel

    • Maintain records of laboratory-specific training on handling procedures

    • Record dates of refresher training sessions

  • Experimental Records:

    • Implement a laboratory notebook system (electronic or paper) with version control

    • Document all experimental conditions including reagents, concentrations, and equipment settings

    • Maintain original data files from analytical instruments with appropriate backup systems

Proper documentation serves both regulatory compliance and scientific reproducibility purposes. These records should be maintained for a minimum of three years after completion of the research or longer if specified by institutional policies .

What biosafety considerations are relevant when working with plant-derived recombinant proteins like ndhA?

While plant-derived recombinant proteins like Huperzia lucidula ndhA generally present minimal biosafety concerns, researchers should still implement appropriate safety measures:

  • Risk Assessment:
    Conduct a comprehensive risk assessment considering:

    • The expression system used (bacterial, yeast, insect, plant)

    • Any modifications that might alter toxicity or allergenicity

    • Concentration and scale of protein handling

    • Potential for aerosol generation during processing

  • Laboratory Practices:

    • Implement Biosafety Level 1 (BSL-1) practices at minimum

    • Use appropriate personal protective equipment including lab coats and gloves

    • Avoid mouth pipetting and follow good microbiological practices

    • Decontaminate work surfaces before and after use with appropriate disinfectants

  • Waste Management:

    • Establish clear protocols for disposal of recombinant material

    • Autoclave or chemically treat all waste containing recombinant organisms

    • Follow institutional guidelines for sharps disposal and liquid waste handling

  • Containment:

    • Conduct procedures that may generate aerosols in biological safety cabinets

    • Implement transport protocols for moving materials between laboratories

    • Secure storage areas to prevent unauthorized access

  • Emergency Response:

    • Develop spill response procedures specific to the scale of operation

    • Post emergency contact information in laboratory spaces

    • Train all personnel on emergency procedures

While plant proteins typically present minimal hazards, the expression systems used to produce them may require additional safety measures. Researchers should consult with their institutional biosafety officer to ensure all appropriate measures are implemented .

How can recombinant ndhA be utilized for studying evolutionary adaptations in photosynthetic electron transport chains?

Recombinant Huperzia lucidula ndhA serves as an excellent model for investigating evolutionary adaptations in photosynthetic electron transport chains across plant lineages. As a lycophyte, Huperzia lucidula represents an evolutionary position between bryophytes and ferns, offering insights into the transition of photosynthetic mechanisms during plant terrestrialization. Researchers can implement comparative experimental designs to:

  • Conduct Phylogenetic Analysis:
    Express and characterize ndhA proteins from representative species across the plant evolutionary tree (liverworts, mosses, lycophytes, ferns, gymnosperms, and angiosperms). Compare kinetic parameters, substrate specificities, and inhibitor sensitivities to identify evolutionary trends and selective pressures.

  • Investigate Environmental Adaptations:
    Test recombinant ndhA performance under conditions mimicking various ecological stresses including high light, drought, and temperature extremes. Compare stress responses across evolutionary lineages to identify adaptation mechanisms.

  • Perform Domain Swapping Experiments:
    Create chimeric proteins combining domains from ndhA of different evolutionary origins to identify which regions contribute to specialized functions or environmental adaptations.

  • Reconstruct Ancestral Sequences:
    Use bioinformatic approaches to predict ancestral ndhA sequences at key evolutionary nodes, then express these reconstructed proteins to experimentally validate functional predictions about photosynthetic adaptations.

  • Analyze Co-evolution Patterns:
    Investigate how ndhA evolution correlates with changes in other components of the NDH complex and the broader photosynthetic apparatus to identify co-evolutionary relationships.

This evolutionary framework provides context for understanding how plant photosynthetic mechanisms adapted from aquatic to terrestrial environments and diversified across different ecological niches .

What experimental approaches can effectively assess the role of ndhA in cyclic electron flow and photoprotection?

To effectively assess the role of Huperzia lucidula ndhA in cyclic electron flow and photoprotection, researchers should implement a multi-level experimental strategy:

  • In Vitro Reconstitution Studies:

    • Reconstitute purified recombinant ndhA with other NDH complex components in liposomes

    • Measure proton pumping activity using pH-sensitive fluorescent dyes

    • Quantify electron transfer rates using artificial electron donors/acceptors

    • Compare activity under varying light intensities and redox conditions

  • Thylakoid Membrane Studies:

    • Incorporate recombinant ndhA into isolated thylakoid membranes

    • Measure P700+ re-reduction kinetics to assess cyclic electron flow rates

    • Monitor transthylakoid proton gradient formation using electrochromic shift measurements

    • Compare oxygen evolution and chlorophyll fluorescence parameters with and without functional ndhA

  • Physiological Measurements:

    • Design complementation studies in plants with knocked-down endogenous ndhA

    • Assess non-photochemical quenching (NPQ) capacity under fluctuating light conditions

    • Measure photosystem I and II quantum yields using pulse amplitude modulated fluorometry

    • Monitor recovery from photoinhibition through chlorophyll fluorescence relaxation kinetics

  • Stress Response Characterization:

    • Test photoprotective function under multiple stress conditions (high light, drought, temperature extremes)

    • Measure reactive oxygen species production using fluorescent probes

    • Quantify ATP/NADPH ratios under various environmental conditions

    • Monitor photosynthetic efficiency during stress recovery phases

These approaches should be conducted with appropriate controls, including the use of specific inhibitors like antimycin A (inhibits ferredoxin-dependent cyclic electron flow) to distinguish NDH-dependent from NDH-independent cyclic electron transport pathways .

How can researchers effectively analyze and interpret kinetic data from ndhA enzyme assays?

Analysis and interpretation of kinetic data from Huperzia lucidula ndhA enzyme assays requires rigorous analytical approaches:

This systematic approach transforms raw kinetic data into mechanistic understanding of ndhA function .

What are the most effective protein expression systems for producing functional recombinant ndhA?

Selecting optimal expression systems for producing functional Huperzia lucidula ndhA requires careful consideration of the protein's membrane-associated nature and complex folding requirements. The table below compares various expression systems with their advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization StrategiesTypical Yield
E. coli- Rapid growth
- Low cost
- Easy genetic manipulation
- Limited membrane protein folding
- Lacks chloroplast-specific chaperones
- No post-translational modifications
- Use C41/C43(DE3) strains
- Lower induction temperature (16-20°C)
- Co-express chloroplast chaperones
- Add membrane-mimicking detergents
0.5-2 mg/L
Yeast (P. pastoris)- Eukaryotic folding machinery
- High-density fermentation
- Moderate cost
- Glycosylation patterns differ
- Membrane composition unlike chloroplasts
- Optimize codon usage
- Use inducible promoters
- Include protease inhibitors
- Supplement with lipids
2-5 mg/L
Insect Cells- Advanced folding machinery
- Suitable for membrane proteins
- Some PTMs
- Expensive
- Technically demanding
- Longer production time
- Optimize MOI and harvest time
- Use lipid supplements
- Optimize cell density
3-8 mg/L
Plant Expression Systems- Native-like folding environment
- Correct PTMs
- Proper membrane insertion
- Slow growth
- Lower yields
- Complex extraction
- Use chloroplast targeting sequences
- Optimize codon usage for plastids
- Develop optimized extraction protocols
0.1-1 mg/L
Cell-Free Systems- Rapid production
- Direct manipulation of environment
- Avoiding toxicity issues
- Very expensive
- Limited scale
- Technical complexity
- Supplement with nanodiscs or liposomes
- Add chaperones
- Optimize redox conditions
0.1-0.5 mg/mg extract

For most research applications requiring functional Huperzia lucidula ndhA, a hybrid approach is recommended: initial screening and mutation studies can utilize E. coli systems (particularly C41/C43 strains designed for membrane proteins), while detailed functional and structural studies should employ plant-based expression systems for native-like protein production. The expression construct should include a chloroplast transit peptide if expressing in whole plants, or appropriate purification tags (preferably C-terminal to avoid interference with transit peptide function) .

How can researchers effectively integrate ndhA functional data with broader plant metabolic and photosynthetic pathways?

Integrating Huperzia lucidula ndhA functional data with broader plant metabolic networks requires multi-scale approaches that connect molecular mechanisms to physiological functions:

  • Multi-omics Data Integration:
    Combine experimental ndhA functional data with transcriptomics, proteomics, and metabolomics datasets to establish regulatory networks. Create correlation matrices between ndhA activity measurements and expression levels of other photosynthetic components under various conditions. Apply principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns in multi-omics datasets that relate to ndhA function.

  • Flux Analysis Approaches:
    Implement metabolic flux analysis (MFA) or flux balance analysis (FBA) incorporating experimentally determined ndhA kinetic parameters. Develop isotope labeling experiments (13C, 18O) to trace electron and energy flow through pathways involving the NDH complex. Create stoichiometric models of the chloroplast electron transport chain with constraints derived from experimental ndhA data.

  • Systems Biology Modeling:
    Develop ordinary differential equation (ODE) models of photosynthetic electron transport incorporating measured ndhA kinetic parameters. Create Petri net models representing regulatory relationships between ndhA activity and other cellular processes. Implement agent-based models simulating emergent photosynthetic behaviors arising from molecular ndhA function.

  • Physiological Correlation Studies:
    Design experiments correlating in vitro ndhA activity with whole-plant physiological parameters like photosynthetic efficiency, stress tolerance, and growth rates. Create response curves showing relationships between ndhA activity levels and photosynthetic parameters under varying light, CO2, and temperature conditions. Implement hierarchical statistical models that connect molecular-level measurements to tissue and organism-level phenotypes.

  • Comparative Genomics and Evolutionary Context:
    Place ndhA functional data in evolutionary context through comparative analysis across plant lineages. Identify correlated genomic changes in photosynthetic apparatus genes that coincide with evolutionary shifts in ndhA function. Create phylogenetic models incorporating functional data to reconstruct the evolutionary history of cyclic electron transport mechanisms.

These integrative approaches transform isolated biochemical data into comprehensive understanding of ndhA's role in plant metabolism and adaptation, providing insights for both fundamental photosynthesis research and potential biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.