Recombinant Huperzia lucidula NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein component of the NAD(P)H dehydrogenase complex found in the chloroplasts of Huperzia lucidula, also known as shining clubmoss . This protein, encoded by the ndhC gene, plays a crucial role in photosynthesis by facilitating electron transfer within the thylakoid membrane .

Basic Information

CategoryDescription
NameRecombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
Source OrganismHuperzia lucidula (Shining clubmoss)
Gene NamendhC
SynonymsNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic; NAD(P)H dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
UniProt IDQ9MUQ9 (Mesostigma viride)

Function

The ndhC subunit is part of the NAD(P)H dehydrogenase (NDH) complex, which is involved in cyclic electron flow around photosystem I (PSI) in chloroplasts . The NDH complex mediates the transfer of electrons from NAD(P)H to plastoquinone, contributing to the regulation of the ATP/NADPH ratio and protection against oxidative stress .

Expression and Purification

Recombinant ndhC is typically expressed in E. coli . After expression, the protein is purified using affinity chromatography, taking advantage of the His-tag .

Availability

Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is available for purchase from several suppliers, including CUSABIO TECHNOLOGY LLC .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
ndhC
Target Protein Sequence
MFLISKYNYFWLFLLLASLIPPVASPISSYSAPVGKGPEKFTSYESGIEPIGDAWIQFQI RYYMFASVFVISDAETVSLYPWAMCFNELGVPASAEASISVTIPIVGSVYAWRRGASEWS
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains. It uses FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) and what is its role in plant metabolism?

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein subunit of the chloroplast NDH complex that participates in cyclic electron flow around photosystem I. The protein functions with EC number 1.6.5.- and is alternatively known as NAD(P)H dehydrogenase subunit 3 or NADH-plastoquinone oxidoreductase subunit 3 . The ndhC gene is nuclear-encoded but functions in the chloroplast, where it plays a critical role in adapting photosynthesis to various environmental conditions.

The intact NDH complex, containing multiple subunits including ndhC, helps plants respond to environmental stresses by maintaining the proton gradient across thylakoid membranes, particularly under conditions where linear electron transport is limited. This function is especially important for photoprotection and optimization of photosynthetic efficiency under changing light and temperature conditions .

How is the ndhC gene organized in the Huperzia lucidula chloroplast genome compared to other lycophytes?

The ndhC gene in Huperzia lucidula is part of a suite of ndh genes preserved in the chloroplast genome, unlike in some other plant species like Selaginella vardei, which has lost all 11 ndh genes . Comparative genomic analyses show that ndhC in H. lucidula is situated in the large single copy (LSC) region of the chloroplast genome.

Table 1: Comparison of chloroplast genome features between H. lucidula and H. serrata

FeatureH. lucidulaH. serrata
Total cpDNA size154,373154,176
LSC104,088104,080
SSC19,65719,658
IR30,62830,438
Total GC content (%)36.336.3
LSC34.434.4
SSC32.832.8
IR44.945.0
Total no. of genes119120
Protein encoding8686
tRNA2930
rRNA44

The gene organization in H. lucidula differs from that found in certain Selaginella species, which have undergone significant genomic rearrangements including inversions and gene losses. These differences reflect the divergent evolutionary histories of lycophyte lineages .

What are the optimal methods for expressing and purifying recombinant H. lucidula ndhC?

Recombinant expression of H. lucidula ndhC typically employs bacterial expression systems with appropriate tags for purification. When working with chloroplast membrane proteins like ndhC, the following methodological considerations are essential:

  • Expression system selection: E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)) are recommended to reduce toxicity and increase yield.

  • Vector design: Constructs should include a fusion tag (His, GST, or MBP) to facilitate purification, with a TEV protease cleavage site for tag removal if necessary.

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) over extended periods (16-24 hours) often improves proper folding.

  • Membrane extraction: Solubilization requires careful selection of detergents; typically, mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) at 1% concentration are effective.

  • Purification strategy: Affinity chromatography followed by size exclusion chromatography produces the highest purity protein samples.

For cell-free expression alternatives, methodologies similar to those used for synthetic PPR constructs can be adapted, including SDS-PAGE and Western blotting validation techniques .

How can researchers accurately measure the enzymatic activity of recombinant ndhC?

Measuring the enzymatic activity of recombinant ndhC presents challenges because it functions as part of a multi-subunit complex. The following methodological approach is recommended:

  • Reconstitution of partial or complete NDH complex: Combine purified ndhC with other essential NDH subunits to reconstitute a functional complex, either in detergent micelles or proteoliposomes.

  • Spectrophotometric assays: Monitor the oxidation of NADH or NADPH (decrease in absorbance at 340 nm) coupled with the reduction of artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP).

  • Oxygen electrode measurements: For more physiologically relevant measurements, oxygen consumption can be monitored using a Clark-type electrode when appropriate electron donors and acceptors are provided.

  • EPR spectroscopy: To study the electron transfer process directly, electron paramagnetic resonance spectroscopy can monitor the redox states of cofactors within the complex.

  • Control experiments: Always perform parallel experiments with known inhibitors (e.g., rotenone or piericidin A) to confirm specificity of the measured activity.

Single-case experimental designs can be adapted for activity assays, particularly the removed-treatment design, where enzyme activity is measured before inhibitor addition, after inhibitor addition, and then after inhibitor removal . This approach provides stronger evidence for causal relationships between specific components and observed activities.

What are the optimal storage conditions for maintaining stability of recombinant ndhC?

Maintaining the stability of recombinant ndhC is critical for reliable experimental results. The recommended storage conditions are:

  • Buffer composition: Tris-based buffer with 50% glycerol, specifically optimized for ndhC stability .

  • Temperature: Store at -20°C for short-term storage, or -80°C for extended preservation of activity.

  • Aliquoting strategy: Divide the purified protein into small working aliquots to avoid repeated freeze-thaw cycles, which significantly reduce stability.

  • Working stock handling: Maintain working aliquots at 4°C for up to one week; beyond this timeframe, protein degradation may compromise experimental results .

  • Detergent considerations: If the protein is solubilized in detergent, ensure the detergent concentration remains above its critical micelle concentration (CMC) throughout storage.

These storage recommendations are specifically tailored for ndhC based on experimental observations that repeated freezing and thawing significantly impacts protein stability and functionality .

How is RNA editing involved in ndhC expression and what methodologies are used to study these events?

RNA editing plays a critical role in ndhC expression in lycophytes like Huperzia lucidula. Both C-to-U and U-to-C editing events have been documented in transcripts from ndh genes, including ndhC. These editing events often correct internal stop codons or modify amino acids critical for protein function.

Methodological approaches to study RNA editing in ndhC include:

  • Comparative transcriptome analysis: RNA-Seq data is compared with genomic sequences to identify editing sites. This approach requires deep sequencing coverage and careful bioinformatic filtering to distinguish true editing events from sequencing errors.

  • RT-PCR and Sanger sequencing: Specific primers flanking potential editing sites are used to amplify cDNA, followed by Sanger sequencing to identify editing events. This method can be used to verify sites identified through high-throughput approaches .

  • PPR protein identification: Pentatricopeptide repeat (PPR) proteins are key factors in RNA editing. Techniques for identifying and characterizing these proteins include:

    • Reverse genetics approaches with PPR mutants

    • RNA immunoprecipitation to identify target binding sites

    • In vitro binding assays to confirm direct interactions

  • Editome construction: Comprehensive catalogs of editing sites across the transcriptome can be built and compared between species to reveal patterns of editing site gains and losses. This approach has revealed that U-to-C editing is confined to hornworts, lycophytes, and ferns, while C-to-U editing is present in almost all land plants .

What approaches can be used to detect the presence or absence of ndhC in diverse plant species?

Detecting the presence or absence of ndhC across plant species requires a multi-faceted approach:

  • PCR-based detection: Design primers targeting conserved regions of ndhC to amplify the gene from genomic DNA. This approach can quickly screen multiple species but may yield false negatives if sequence divergence prevents primer binding.

  • Whole chloroplast genome sequencing: Using next-generation sequencing technologies to assemble complete chloroplast genomes allows for comprehensive gene content analysis. This approach revealed the complete absence of all 11 ndh genes in Selaginella vardei compared to their presence in other lycophytes .

  • Long PCR and Sanger verification: For confirmation of genome structure and gene presence/absence, long PCR experiments across the whole plastome followed by Sanger sequencing provides high-confidence verification, as demonstrated in studies of Selaginella species .

  • Transcriptome analysis: RNA-Seq data can confirm whether ndhC is transcriptionally active, which is particularly important in species where the gene may be present but not expressed.

  • Protein detection methods: Western blotting with antibodies against ndhC or mass spectrometry-based proteomics can verify protein presence at the translational level.

These methodologies have revealed significant variation in ndh gene content across plant lineages, with some species like Selaginella vardei having lost all ndh genes while they are retained in other lycophytes like Huperzia lucidula .

How can quasi-experimental designs be applied to study ndhC function in stress adaptation?

Studying the role of ndhC in plant stress adaptation requires sophisticated experimental designs that can establish causal relationships. Quasi-experimental designs offer rigorous methodological frameworks:

These quasi-experimental approaches are particularly valuable when complete randomization is not feasible due to the nature of plant physiological studies or genetic material availability.

What methods can be used to investigate interactions between ndhC and other components of the chloroplast electron transport chain?

Investigating protein-protein interactions between ndhC and other components of the electron transport chain requires specialized methodologies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against ndhC or tagged recombinant versions to pull down associated proteins, followed by mass spectrometry identification of interaction partners.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing split fluorescent protein fragments to ndhC and potential interaction partners, in vivo interactions can be visualized when the fragments reconstitute a functional fluorophore.

  • Yeast two-hybrid (Y2H) screening: Modified Y2H systems adapted for membrane proteins can identify direct protein interactions, though care must be taken when interpreting results due to the hydrophobic nature of these proteins.

  • Blue native PAGE: This technique separates intact protein complexes under non-denaturing conditions, allowing visualization of ndhC-containing complexes and identification of their components through mass spectrometry.

  • Cryo-electron microscopy: For structural studies of the entire NDH complex, cryo-EM provides high-resolution insights into the positioning and interactions of ndhC within the larger assembly.

These methodologies have revealed that ndhC functions in close association with other NDH subunits and forms dynamic interactions with components of photosystem I under varying environmental conditions.

How can synthetic biology approaches be used to study ndhC function?

Synthetic biology offers powerful approaches to investigate ndhC function:

  • Assembly of synthetic constructs: Using modular cloning systems like Golden Gate or Gibson Assembly, researchers can create modified versions of ndhC with specific mutations or domain swaps to test structure-function relationships. These approaches can be similar to those used for synthetic PPR constructs .

  • Heterologous expression systems: Expressing ndhC in model organisms lacking endogenous NDH complexes allows for controlled functional studies without background activity.

  • In vitro reconstitution: Building minimal NDH subcomplexes with defined components helps determine the essential elements for different aspects of NDH function.

  • Complementation studies: Transforming ndhC-deficient plants with synthetic variants can reveal which domains and residues are essential for in vivo function.

  • High-throughput mutagenesis: Creating libraries of ndhC variants and screening for altered function allows mapping of critical residues and domains.

For synthetic constructs, expression verification using cell-free systems combined with SDS-PAGE and Western blotting provides rapid assessment of protein production before proceeding to functional studies .

What does comparative genomic analysis reveal about ndhC evolution across plant lineages?

Comparative genomic analysis of ndhC across plant lineages reveals significant evolutionary patterns:

  • Differential gene retention: While many plant species retain ndhC in their chloroplast genomes, the gene has been lost in certain lineages. For example, all 11 ndh genes (including ndhC) are absent in Selaginella vardei, while they are present in Huperzia lucidula . This pattern suggests that ndh genes can become dispensable under certain ecological conditions.

  • Structural rearrangements: The genomic context of ndhC varies across species due to inversions and other rearrangements. For instance, comparing chloroplast genomes between Selaginella species reveals inversions of large fragments containing ndh genes, indicating dynamic genome evolution in lycophytes .

  • RNA editing patterns: The evolution of RNA editing in ndhC transcripts shows lineage-specific patterns. U-to-C editing is confined to hornworts, lycophytes, and ferns, while C-to-U editing is more widespread across land plants . This suggests that editing mechanisms evolved differently across plant lineages.

  • Sequence conservation: Functional domains of ndhC show higher sequence conservation compared to non-functional regions, reflecting selective pressure to maintain enzymatic activity while allowing variation in other regions.

  • Correlation with habitat: The presence or absence of ndhC and other ndh genes often correlates with ecological adaptations, suggesting that environmental factors have shaped the evolution of the NDH complex.

These evolutionary patterns provide insights into the functional importance of ndhC in different plant lineages and its role in adaptation to diverse environmental conditions.

What is the significance of RNA editing in ndhC across the evolutionary history of land plants?

RNA editing in ndhC transcripts has profound evolutionary significance:

  • Correction of genomic mutations: RNA editing often corrects otherwise deleterious mutations in the genomic sequence, effectively serving as a post-transcriptional repair mechanism that allows plants to maintain functional proteins despite genomic changes.

  • Evolutionary flexibility: The presence of RNA editing mechanisms provides evolutionary flexibility by allowing certain mutations to accumulate in the genome while maintaining protein function through editing.

  • Lineage-specific patterns: Analysis of editomes across plant species reveals that U-to-C editing is restricted to hornworts, lycophytes, and ferns, while C-to-U editing is more widespread . This pattern suggests independent evolution of editing mechanisms.

  • Correlation with PPR protein evolution: The evolution of RNA editing is closely tied to the evolution of PPR proteins that serve as editing factors. The first identified plant C-to-U RNA editing factor was a PPR protein essential for editing ndhD (a related ndh gene) .

  • Gradual loss in certain lineages: Some plant lineages show a reduction or complete loss of RNA editing sites in ndhC, suggesting that editing became unnecessary or disadvantageous in these groups.

Research methodologies to study this evolutionary pattern include building detailed editomes across diverse species and analyzing PPR protein diversity, which has revealed patterns of gain and loss of editing sites across evolutionary time .

What are the current methodological limitations in studying recombinant ndhC and how might they be addressed?

Current research on recombinant Huperzia lucidula ndhC faces several methodological challenges:

  • Membrane protein expression difficulties: As a membrane protein, ndhC is challenging to express in recombinant systems. Future directions include developing specialized expression systems with optimized membrane mimetics or nanodiscs for improved yield and stability.

  • Complex assembly requirements: Since ndhC functions as part of a multi-subunit complex, studying its isolated function may not reflect physiological activity. Development of co-expression systems for multiple NDH subunits would provide more relevant functional insights.

  • Limited structural information: The three-dimensional structure of ndhC remains poorly characterized. Advanced cryo-EM techniques and integrative structural biology approaches combining computational prediction with experimental validation offer promising solutions.

  • Variable RNA editing: The presence of RNA editing in ndhC transcripts complicates genomic analysis. Developing improved bioinformatic pipelines specifically designed to detect and quantify editing events would enhance accuracy.

  • Functional redundancy: Potential redundancy in electron transport pathways complicates interpretation of ndhC function. More sophisticated multi-level omics approaches that integrate transcriptomics, proteomics, and metabolomics would provide a more comprehensive understanding of ndhC's role in plant metabolism.

These limitations can be addressed through interdisciplinary approaches combining advances in membrane protein biochemistry, structural biology, and systems biology.

How might advances in synthetic biology and genetic engineering create new applications for ndhC research?

Emerging technologies in synthetic biology and genetic engineering open exciting possibilities for ndhC research:

  • Designer NDH complexes: Engineering synthetic NDH complexes with modified ndhC subunits could create plants with enhanced stress tolerance or photosynthetic efficiency under suboptimal conditions.

  • RNA editing modulators: Developing synthetic PPR proteins that target specific editing sites in ndhC transcripts could allow precise manipulation of editing efficiency, enabling studies of how editing affects protein function .

  • Biosensor development: Modified ndhC proteins could serve as sensitive biosensors for detecting changes in chloroplast redox state or electron transport efficiency, providing new tools for monitoring plant stress responses.

  • Heterologous expression optimization: Advanced codon optimization algorithms and synthetic biology tools could overcome current limitations in recombinant ndhC expression, enabling large-scale production for structural and functional studies.

  • CRISPR-based approaches: CRISPR/Cas systems adapted for chloroplast genome editing would allow precise modification of ndhC in its native context, facilitating in vivo functional studies without the complications of nuclear transformation.

These advanced applications build upon current methodologies like the rapid assembly of synthetic factors but extend them to address more complex questions about ndhC function and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.