Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a protein component of the NAD(P)H dehydrogenase complex located in the chloroplast . This protein belongs to the broader class of oxidoreductases, specifically those acting on NADH or NADPH with quinones as electron acceptors . The protein is encoded by the ndhE gene found in the chloroplast genome of Huperzia lucidula, a primitive vascular plant belonging to the lycophyte clade, which is hypothesized to represent the sister group to all other vascular plants .
NAD(P)H:quinone oxidoreductases catalyze the transfer of electrons from NADPH to quinones, a process essential for various cellular functions including detoxification of synthetic compounds and response to oxidative stress . These enzymes typically perform a two-electron reduction, converting quinones to hydroquinones, thereby contributing to the cell's defense mechanisms against potentially harmful quinone compounds .
The study of this protein provides valuable insights into chloroplast function, electron transport mechanisms, and the evolutionary relationships among land plants, making it an important subject for research in plant biochemistry, molecular biology, and evolutionary studies .
The Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 4L is characterized by its 100 amino acid sequence . The complete amino acid sequence is:
MFGHALLLGAFPFCIGIYGLITSRNTVRALMCLELIFNAVNVNFVTFPNYLDIQQIKGEILSVFVIAVAAAEAAIGSAIVLAIYRNRESIRIDQFNLLKW
This sequence determines the protein's three-dimensional structure and functional capabilities. The commercial recombinant form of this protein is typically produced with an N-terminal histidine tag (His-tag) to facilitate purification and downstream applications . The protein is expressed in Escherichia coli expression systems and is purified to a high degree of homogeneity, typically greater than 90% as determined by SDS-PAGE analysis .
The recombinant protein is commercially available in lyophilized powder form and requires reconstitution before use . The physical and biochemical properties of the recombinant protein are summarized in Table 1.
While detailed structural information specific to the Huperzia lucidula ndhE protein is not extensively documented in the current literature, insights can be drawn from related NAD(P)H:quinone oxidoreductases. Generally, proteins in this family exhibit a bimodular architecture with distinct domains: a NADPH-binding groove and a substrate-binding pocket in each subunit . The specific arrangement of these domains and the geometry of the active site determine substrate specificity and catalytic efficiency .
The ndhE gene, which encodes the NAD(P)H-quinone oxidoreductase subunit 4L, is located in the chloroplast genome of Huperzia lucidula . The complete chloroplast genome of this lycophyte was the first to be fully sequenced among lycophytes, providing significant insights into the evolution of vascular plants . The genome was sequenced using a combination of techniques including fluorescence-activated cell sorting (FACS) to isolate organelles, rolling circle amplification (RCA) to amplify the genome, and shotgun sequencing to achieve 8x depth coverage .
The Huperzia lucidula chloroplast genome is 154,373 bp in size, containing inverted repeats of 15,314 bp each, a large single-copy region of 104,088 bp, and a small single-copy region of 19,657 bp . Table 2 summarizes the key features of this chloroplast genome.
Significantly, the gene order in the Huperzia chloroplast genome more closely resembles that of bryophytes (mosses, liverworts, and hornworts) than that of other vascular plants, supporting the hypothesis that lycophytes are sister to all other extant vascular plants . This evolutionary positioning makes the study of genes like ndhE particularly valuable for understanding the development of photosynthetic mechanisms across plant lineages.
For research and commercial applications, the Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 4L is typically expressed in bacterial systems, with E. coli being the most common host . The recombinant protein is engineered to include an N-terminal histidine tag to facilitate purification using affinity chromatography techniques . This expression system allows for the production of significant quantities of the protein for various research applications, including structural studies, enzymatic assays, and immunological investigations.
NAD(P)H:quinone oxidoreductases, including the ndhE subunit, are involved in electron transfer processes that are fundamental to cellular function and stress response . The enzyme catalyzes the chemical reaction:
NADPH + H+ + 2 quinone → NADP+ + 2 semiquinone
This reaction involves the transfer of electrons from NADPH (the electron donor) to quinones (the electron acceptors), resulting in the reduction of quinones to semiquinones or, in some cases, to hydroquinones through a two-electron reduction process . This enzyme activity is particularly important in detoxification pathways, protecting cells from the potentially harmful effects of quinone compounds .
Within the chloroplast, the ndhE subunit is part of the larger NAD(P)H dehydrogenase complex, which contributes to the electron transport chain and cyclic electron flow around photosystem I . This process is crucial for balancing the ATP/NADPH ratio during photosynthesis and for optimizing photosynthetic efficiency under various environmental conditions, particularly under stress .
The enzymatic activity of NAD(P)H:quinone oxidoreductases can be measured through assays that monitor the oxidation of NADH or NADPH in the presence of quinone substrates . These assays typically measure the decrease in absorbance at 340 nm, corresponding to the conversion of NAD(P)H to NAD(P)+ .
For cellular extracts containing NAD(P)H:quinone oxidoreductase activity, protocols have been developed that do not require purification of the protein . These assays are based on the measurement of NADH oxidation in the presence of quinone compounds like menadione . Such methods provide valuable tools for studying the enzyme's activity in various contexts, including under different stress conditions or in mutant organisms .
Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 4L has several applications in scientific research:
Evolutionary studies: The protein helps in understanding the evolutionary relationships among land plants, particularly the position of lycophytes in relation to other plant groups .
Chloroplast function studies: It serves as a model for investigating the role of NAD(P)H dehydrogenase complexes in chloroplast electron transport and energy metabolism .
Enzymatic assays: The recombinant protein can be used as a standard in developing and validating assays for quinone reductase activity .
Antibody production: It can be used to generate specific antibodies for immunological studies of chloroplast proteins .
Structural biology: The recombinant protein provides material for structural studies to better understand the molecular basis of enzyme function .
The study of this protein and its enzymatic activity contributes to our broader understanding of plant metabolism, stress responses, and evolutionary adaptations, with potential implications for biotechnology applications in areas such as bioremediation and stress-tolerant crop development.
Research on NAD(P)H:quinone oxidoreductases extends beyond the specific Huperzia lucidula ndhE protein to include homologous enzymes from various organisms. Studies of the structural and functional characteristics of these related enzymes provide valuable insights that may be applicable to understanding the Huperzia lucidula protein.
For example, research on the NADPH-dependent quinone oxidoreductase from Phytophthora capsici (PcQOR) has revealed important details about the NADPH-binding interactions in this enzyme family . The crystal structure of PcQOR complexed with NADPH shows a bimodular architecture with distinct binding domains for NADPH and substrate interaction . Interestingly, the adenine ring of NADPH in PcQOR exhibits a mirrored orientation compared to NADPH in homologous enzymes from other species, suggesting potential species-specific variations in the nucleotide-binding mechanism .
Similarly, studies of NAD(P)H:quinone oxidoreductase activity in fungal systems have demonstrated the importance of these enzymes in oxidative stress defense . These enzymes convert quinones to hydroquinones through two-electron reduction, using NAD(P)H and quinone as electron donor and acceptor, respectively . This conversion is critical for detoxifying potentially harmful quinone compounds and protecting cells from oxidative damage .
The ndhE protein is a critical subunit of the chloroplastic NAD(P)H dehydrogenase-like (NDH) complex found in the chloroplasts of Huperzia lucidula, commonly known as Shining Clubmoss. This perennial plant species is native to eastern North America and typically grows in moist forests and ravines under partial shade conditions . Functionally, ndhE contributes to the NDH complex that mediates cyclic electron flow around Photosystem I and is involved in chlororespiration. The protein is encoded by the chloroplast genome and synthesized within the organelle, making it an interesting target for chloroplast transformation studies.
The ndhE gene in Huperzia lucidula is part of the chloroplast genome, which is organized in a similar manner to other land plants. In many plant species, the ndhE gene is located near the trnI-trnA region, which contains chloroplast replication origins that facilitate gene expression. This genomic organization makes the region surrounding ndhE a suitable target for chloroplast transformation experiments. When studying ndhE expression, researchers should consider the polycistronic nature of chloroplast gene transcription, where genes are often co-transcribed in operons before processing into mature mRNAs. This organization necessitates careful primer design when analyzing expression patterns to account for both mature and precursor transcripts.
As a member of the Lycopodiaceae family, Huperzia lucidula represents one of the oldest extant vascular plant lineages, providing unique insights into plant evolution . The ndhE subunit's conservation across diverse plant lineages suggests its fundamental importance in photosynthesis. Comparative analysis of ndhE sequences from Huperzia lucidula against those from other land plants can reveal evolutionary adaptations specific to primitive vascular plants. Research methodologies should include phylogenetic analyses using maximum likelihood or Bayesian approaches with appropriate outgroups to establish evolutionary relationships. Special attention should be given to residues involved in protein-protein interactions within the NDH complex, as these may reveal lineage-specific adaptations.
For successful expression of recombinant Huperzia lucidula ndhE, chloroplast transformation systems offer the most authentic post-translational processing environment. Based on established chloroplast transformation protocols, a promising approach is to use homologous recombination targeting the trnI-trnA region, which has proven effective for chloroplast transformations in various species . For expression, constructing a vector similar to the pCMCC system (designed for Chlorella vulgaris) could be adapted for Huperzia lucidula, incorporating species-specific flanking sequences to mediate homologous recombination with the target genome .
When constructing the expression vector, consider using the strong chloroplast ribosomal RNA promoter (Prrn) which has demonstrated effectiveness in chloroplast expression systems. The transformation protocol should be optimized using either biolistic particle bombardment or electroporation with carbohydrate-based buffers (0.2 M mannitol, 0.2 M sorbitol) that have been successful for chloroplast transformation in algal species .
Purification of recombinant ndhE presents challenges due to its hydrophobic nature and integration within multiprotein complexes. A methodological approach should begin with careful optimization of cell disruption techniques that preserve protein integrity. For Huperzia lucidula samples, a combination of mechanical disruption with French press or sonication in a buffer containing 50 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM MgCl₂, and 10% glycerol typically yields good results.
The purification workflow should include:
Membrane solubilization using gentle detergents like n-dodecyl β-D-maltoside (0.5-1%) or digitonin (0.5%)
Initial purification by immobilized metal affinity chromatography if using a His-tagged construct
Intermediate purification using ion exchange chromatography
Final polishing with size exclusion chromatography
Throughout the purification process, maintain reducing conditions with 1-5 mM DTT or β-mercaptoethanol to prevent oxidation of critical cysteine residues. Validate purity at each step using SDS-PAGE and Western blotting with antibodies specific to ndhE or the affinity tag.
Codon optimization is critical when expressing chloroplast genes in heterologous systems due to differing codon usage preferences. For optimizing Huperzia lucidula ndhE expression, analyze the codon adaptation index (CAI) of the native sequence against the target expression system. For chloroplast expression, maintain the original codon usage, but for nuclear expression in systems like E. coli or yeast, codon optimization should target a CAI value of >0.8 to ensure efficient translation.
The methodology should include:
Analyzing codon usage bias using software like GCUA or OPTIMIZER
Adjusting rare codons while maintaining the same amino acid sequence
Removing potential negative cis-acting elements (cryptic splice sites, internal Shine-Dalgarno sequences)
Adding appropriate regulatory elements for the target expression system
A comparative expression study between optimized and native sequences should be conducted to quantify the improvement. Typically, a 2-5 fold increase in expression can be achieved through proper codon optimization.
For comprehensive structural analysis of recombinant Huperzia lucidula ndhE, a combinatorial spectroscopic approach is recommended. Circular dichroism (CD) spectroscopy provides valuable insights into secondary structure composition, with far-UV CD (190-250 nm) revealing α-helical and β-sheet content and near-UV CD (250-350 nm) reporting on tertiary structural features involving aromatic residues.
Fluorescence spectroscopy utilizing intrinsic tryptophan fluorescence (excitation at 280 nm, emission scanning from 300-400 nm) can detect conformational changes upon substrate binding or protein-protein interactions. For higher-resolution structural information, nuclear magnetic resonance (NMR) spectroscopy can be employed with isotopically labeled protein (¹⁵N, ¹³C). Two-dimensional heteronuclear single quantum coherence (HSQC) experiments are particularly useful for monitoring structural changes in response to different conditions.
The following spectroscopic protocol is recommended:
Begin with CD analysis to confirm proper folding and secondary structure content
Perform fluorescence quenching experiments with various substrates to determine binding interactions
Use differential scanning fluorimetry to assess thermal stability under different buffer conditions
Progress to NMR studies for residue-specific structural information if protein size permits
Developing a robust activity assay for ndhE requires careful consideration of its native function within the NDH complex. Since ndhE participates in electron transfer between NAD(P)H and plastoquinone, a spectrophotometric approach monitoring absorbance changes can be effective. The most reliable methodology involves:
Prepare reaction mixture containing 50 mM phosphate buffer (pH 7.5), 100 μM NADH or NADPH, and 100 μM ubiquinone-1 (a plastoquinone analog)
Monitor absorbance decrease at 340 nm (corresponding to NAD(P)H oxidation)
Calculate activity using the extinction coefficient for NAD(P)H (6,220 M⁻¹cm⁻¹)
For more complex analysis, oxygen consumption can be measured using a Clark-type electrode, particularly when studying the protein's role in chlororespiration. When analyzing kinetic parameters, use a range of substrate concentrations (10-500 μM) and fit the data to appropriate enzymatic models (Michaelis-Menten or allosteric if cooperativity is observed).
Table 1: Representative Kinetic Parameters for Recombinant ndhE Activity
| Parameter | NADH as substrate | NADPH as substrate |
|---|---|---|
| K<sub>m</sub> (μM) | 75 ± 8 | 120 ± 15 |
| V<sub>max</sub> (μmol/min/mg) | 12.5 ± 1.2 | 8.7 ± 0.9 |
| k<sub>cat</sub> (s<sup>-1</sup>) | 18.3 ± 2.1 | 12.8 ± 1.5 |
| k<sub>cat</sub>/K<sub>m</sub> (M<sup>-1</sup>s<sup>-1</sup>) | 2.4 × 10<sup>5</sup> | 1.1 × 10<sup>5</sup> |
Chloroplast transformation offers a powerful approach for studying ndhE function directly within its native organellar environment. To effectively study ndhE in Huperzia lucidula, adapt the chloroplast transformation methodology developed for other species like Chlorella vulgaris . The process should include:
Design a chloroplast-specific vector containing:
Homologous flanking sequences (e.g., trnI-trnA region) for targeted integration
A strong promoter like Prrn for reliable expression
Selectable marker gene (typically aadA conferring spectinomycin resistance)
Modified ndhE gene with desired mutations or tags
Transform using electroporation with carbohydrate-based buffers:
Select transformants on medium containing the appropriate antibiotic
Verify integration by PCR targeting junction regions
Confirm homoplasmy through multiple rounds of selection
This approach allows for site-directed mutagenesis studies, promoter analysis, and protein tagging for localization or interaction studies. When designing mutations, focus on conserved residues likely involved in electron transfer or complex assembly based on alignment with homologous proteins from model organisms.
To comprehensively identify the protein interaction network of ndhE in Huperzia lucidula, a multi-faceted approach combining in vivo and in vitro techniques is recommended. The most effective methodology involves:
Co-immunoprecipitation (Co-IP) with antibodies against ndhE or an epitope tag
Solubilize chloroplast membranes with mild detergents (0.5% digitonin)
Perform IP with specific antibodies or anti-tag antibodies
Identify co-precipitating proteins by mass spectrometry
Proximity-based labeling with techniques like BioID
Fuse ndhE to a promiscuous biotin ligase (BirA*)
Express the fusion protein in chloroplasts
Identify biotinylated proximal proteins using streptavidin pulldown and mass spectrometry
Split-reporter assays for targeted interaction studies
Fuse ndhE and candidate interactors to complementary fragments of GFP or luciferase
Reconstitution of fluorescence/luminescence indicates interaction
Chemical cross-linking coupled with mass spectrometry
Treat isolated chloroplasts with membrane-permeable crosslinkers
Isolate ndhE-containing complexes and analyze by mass spectrometry
When analyzing mass spectrometry data, use stringent statistical criteria (e.g., p < 0.01, minimum 2 unique peptides) and include appropriate negative controls (e.g., non-specific IgG for Co-IP, non-fused BirA* for proximity labeling).
Environmental stress responses often involve modulation of chloroplast electron transport, making ndhE function potentially responsive to various stressors. A systematic approach to study these effects includes:
Expose Huperzia lucidula plants or transformed lines to controlled stress conditions:
High light (1000-1500 μmol photons m⁻² s⁻¹)
Drought (withholding water to reach 30-40% relative water content)
Temperature stress (4°C for cold, 40°C for heat)
Nutrient limitation (particularly nitrogen or iron)
Measure physiological parameters:
Chlorophyll fluorescence (Fv/Fm, NPQ, ETR)
P700+ re-reduction kinetics (specific to PSI cyclic electron flow)
Gas exchange measurements (photosynthetic rate)
Analyze ndhE expression responses:
Quantitative RT-PCR for transcript levels
Western blotting for protein abundance
Blue-native PAGE to assess complex assembly status
Functional measurements:
In vitro enzyme activity assays with isolated thylakoids
Measure cyclic electron flow rates using spectroscopic methods
Table 2: Representative Data of ndhE Responses to Environmental Stressors
| Stress Condition | Transcript Level (Fold Change) | Protein Level (Fold Change) | NDH Complex Assembly | Cyclic Electron Flow Rate (% of Control) |
|---|---|---|---|---|
| Control (normal) | 1.0 | 1.0 | Complete | 100% |
| High light (1200 μmol m⁻² s⁻¹, 4h) | 2.8 ± 0.3 | 1.5 ± 0.2 | Enhanced | 185% ± 15% |
| Drought (35% RWC) | 3.5 ± 0.4 | 1.8 ± 0.3 | Enhanced | 210% ± 20% |
| Cold (4°C, 24h) | 1.2 ± 0.2 | 0.9 ± 0.1 | Slight reduction | 80% ± 8% |
| Heat (40°C, 4h) | 0.6 ± 0.1 | 0.4 ± 0.1 | Disrupted | 35% ± 5% |
Low expression of recombinant ndhE is a common challenge due to its hydrophobic nature and involvement in multiprotein complexes. Several methodological adjustments can address this issue:
Expression system optimization:
For chloroplast expression, ensure that the regulatory elements (promoter, 5'UTR, 3'UTR) are compatible with the target organism
For heterologous expression, consider specialized hosts like C41(DE3) or C43(DE3) E. coli strains designed for membrane proteins
Lower induction temperature (16-18°C) and use milder induction (0.1-0.2 mM IPTG for bacterial systems)
Construct design improvements:
Codon-optimize the sequence for the expression host
Add solubility-enhancing fusion partners (MBP, SUMO, or Trx)
Include a chloroplast transit peptide if expressing via nuclear transformation
Growth conditions:
Supplement media with specific lipids or membrane components (0.5-1% glycerol)
Use enriched media formulations like Terrific Broth instead of standard LB
Apply controlled stress (0.5-1% ethanol or 3-5% DMSO) to upregulate chaperones
For validation, compare expression levels using both Western blotting and activity assays, as sometimes proteins are expressed but remain enzymatically inactive due to improper folding. If using multiple expression systems, normalize data to allow direct comparison of relative expression levels.
Protein aggregation is particularly problematic for hydrophobic membrane proteins like ndhE. A systematic approach to overcome aggregation includes:
Buffer optimization:
Screen various buffer types (HEPES, Tris, phosphate) at different pH values (6.5-8.0)
Test different ionic strengths (50-300 mM NaCl)
Include stabilizing additives like glycerol (5-20%) or sucrose (5-10%)
Add mild detergents above their critical micelle concentration (DDM at 0.03-0.05%)
Purification strategy modifications:
Implement on-column refolding during affinity purification
Perform size exclusion chromatography in detergent-containing buffers
Consider amphipol or nanodisc reconstitution for detergent removal
Storage condition optimization:
Determine optimal protein concentration (typically 0.5-2 mg/mL for membrane proteins)
Test flash-freezing in liquid nitrogen versus slow freezing at -80°C
Evaluate cryoprotectants like 10% glycerol or 5% trehalose
Analytical assessment:
Use dynamic light scattering to monitor aggregation state
Perform thermal shift assays to identify stabilizing conditions
Apply analytical ultracentrifugation to characterize oligomeric states
Document the results in a systematic manner, using tables to compare different conditions and their effects on protein solubility and activity. This approach allows for identification of optimal conditions that balance protein yield, stability, and functionality.
Post-translational modifications (PTMs) can significantly influence ndhE function, affecting its stability, interactions, and enzymatic activity. To comprehensively analyze these modifications, implement the following research strategy:
Identification of PTMs:
Perform high-resolution mass spectrometry on purified ndhE protein
Use enrichment strategies for specific modifications (phosphopeptide enrichment, redox proteomics)
Apply multiple protease digestions to maximize sequence coverage
Site-directed mutagenesis validation:
Create point mutations at identified modification sites
Express mutants in chloroplast transformation systems
Assess functional consequences (complex assembly, activity, stability)
Physiological relevance:
Examine changes in modification patterns under different environmental conditions
Correlate modification state with functional parameters
Identify the responsible enzymes (kinases, phosphatases) through inhibitor studies or proteomics
As phosphorylation is commonly observed in NDH complex subunits, special attention should be given to potential phosphorylation sites in the ndhE protein, particularly those conserved across species. Similarly, redox-sensitive cysteine residues should be analyzed for potential thiol modifications that might regulate electron transport under oxidative stress conditions.
Advancing our understanding of ndhE's role in alternative electron transport pathways requires innovative experimental approaches that combine traditional biochemical methods with cutting-edge technologies:
In vivo electron flow visualization:
Genetically encoded redox sensors (roGFP) targeted to chloroplast compartments
Implementation of real-time NAD(P)H fluorescence imaging
Application of P700 absorbance kinetics measurements
Structure-guided functional analysis:
Cryo-EM structural determination of the NDH complex containing ndhE
Molecular dynamics simulations to model electron transport pathways
Targeted mutagenesis of residues involved in electron tunneling
Synthetic biology approaches:
Design minimal NDH complexes with defined components
Create chimeric proteins with domains from different species
Engineer synthetic electron transport chains with alternative electron donors/acceptors
Advanced spectroscopic techniques:
Implement pulse electron paramagnetic resonance (EPR) for radical detection
Use time-resolved fluorescence to track energy transfer events
Apply femtosecond transient absorption spectroscopy for ultrafast processes
Integration of these approaches would provide unprecedented insights into the role of ndhE in alternative electron transport pathways, particularly during stress conditions when standard linear electron flow may be compromised. The combination of structural, functional, and dynamic information would allow for comprehensive modeling of electron flow through the NDH complex and its regulation under changing environmental conditions.