Recombinant Huperzia lucidula NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Huperzia lucidula NAD(P)H-Quinone Oxidoreductase Subunit 6, Chloroplastic (ndhG)

Recombinant Huperzia lucidula NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) is a genetically engineered protein derived from the chloroplast-localized NDH complex of Huperzia lucidula, a lycophyte commonly known as shining clubmoss. This subunit is integral to the chloroplast NAD(P)H dehydrogenase (NDH) complex, which facilitates cyclic electron transport and chlororespiratory pathways in photosynthetic organisms . The recombinant form enables biochemical and structural studies by allowing high-purity production in heterologous systems such as Escherichia coli .

Molecular Features

  • Gene: ndhG (plastid-encoded) .

  • Protein Length: 199 amino acids (for Huperzia lucidula variant) .

  • Domains: Predicted transmembrane helices and conserved iron-sulfur (Fe-S) cluster-binding motifs, critical for electron transfer .

Subcomplex Localization

The ndhG subunit is part of the chloroplast NDH membrane subcomplex, which includes seven plastid-encoded subunits (NdhA–NdhG). This subcomplex anchors the NDH complex to thylakoid membranes .

SubcomplexSubunitsFunction
Membrane subcomplexNdhA, NdhB, NdhG, NdhD, etc.Structural anchoring; proton translocation
Subcomplex ANdhH–NdhK, NdhL–NdhOElectron transfer; cofactor binding

Functional Role in Chloroplast Physiology

The ndhG subunit contributes to two primary processes:

  1. Cyclic Electron Transport: Facilitates electron recycling around Photosystem I (PSI) to generate ATP, particularly under stress or low-light conditions .

  2. Chlororespiration: Maintains redox homeostasis by oxidizing NAD(P)H and reducing plastoquinone, preventing over-reduction of the photosynthetic electron transport chain .

Key functional attributes:

  • Electron Shuttling: Transfers electrons via FMN and Fe-S centers to plastoquinone .

  • Proton Translocation: Couples electron transfer to proton gradient formation, supporting ATP synthesis .

Production Workflow

  • Expression System: E. coli with N-terminal His-tag for affinity purification .

  • Storage: Tris-based buffer with 50% glycerol; stable at -80°C .

ParameterDetails
Host SpeciesHuperzia lucidula (UniProt: Q5SCZ0)
Expression VectorCustom plasmid optimized for chloroplast protein expression
Purity>90% (SDS-PAGE verified)
ApplicationsEnzyme kinetics, antibody production, structural studies

Assembly and Stability

  • The NDH complex assembles via a multistep process requiring chaperonins like Cpn60β4 for folding ndhH, a partner subunit .

  • Mutants lacking ndhG show impaired plastoquinone reduction and disrupted redox balance, confirming its role in electron transport .

Comparative Analysis Across Species

SpeciesndhG FeaturesUnique Adaptations
Huperzia lucidula199 residues; Fe-S motifsOptimized for lycophyte chlororespiration
Arabidopsis thaliana189 residues; stromal interaction domainsEnhanced cyclic electron flow under stress
Morus indica176 residues; truncated C-terminalReduced proton translocation efficiency

Future Research Directions

  1. Cryo-EM Studies: Resolve high-resolution structures to elucidate ndhG’s role in proton channeling .

  2. Stress Response Mechanisms: Investigate ndhG’s contribution to drought and high-light adaptation in non-angiosperms .

  3. Biotechnological Applications: Engineer ndhG variants to enhance photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are defaulted with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
ndhG
Target Protein Sequence
MSVIDLPEFFYKAILLLIESGVILGSLGVVLFTNIVYSAFLLGWVPVCISFLYILLNADF VAAVQILIYVGTINVLIVFAVMLINKPQYFRFLKYWTVGDGTALALCTSPFLSIIAAILS TPWSKISLIVLSNKIVEEPLTDNVQRIGFHSLTDSPLPFELLSIILLVAPVGAITMARRE EAVEAEESEALKTKDDFPF
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, thereby conserving the redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ndhG in Huperzia lucidula chloroplasts?

The ndhG gene is one of several ndh genes encoded in the Huperzia lucidula chloroplast genome. H. lucidula was the first lycophyte with a complete chloroplast genome sequence (GenBank accession no. NC_006861) . The complete chloroplast genome of H. lucidula is 154,373 bp in length with 36.3% GC content, containing approximately 120 unique genes including protein-coding genes, rRNAs, and tRNAs . The ndhG gene encodes subunit 6 of the NAD(P)H-quinone oxidoreductase complex, which functions in cyclic electron transport in chloroplasts.

What role does the ndhG protein play in chloroplast function?

The ndhG protein functions as subunit 6 of the NAD(P)H dehydrogenase (NDH) complex in chloroplasts. This complex participates in:

  • Cyclic electron flow around photosystem I

  • Chlororespiration

  • Protection against photo-oxidative stress

  • Optimization of photosynthesis under varying environmental conditions

The NDH complex's electron transport contributes to proton gradient generation across the thylakoid membrane, ultimately supporting ATP synthesis during photosynthesis.

What expression systems are most effective for producing recombinant H. lucidula ndhG protein?

For expressing recombinant chloroplastic proteins like ndhG from Huperzia lucidula, researchers typically employ the following systems:

Recommended Expression Systems:

  • E. coli-based systems with chloroplast transit peptide removal for basic structure-function studies

  • Plant-based expression systems (tobacco, Arabidopsis) for functional studies requiring proper folding and post-translational modifications

  • Cell-free translation systems for rapid screening of protein variants

Methodological Approach:

  • Clone the ndhG coding sequence without transit peptide

  • Optimize codon usage for the chosen expression system

  • Include appropriate affinity tags (His6, GST, etc.) for purification

  • If membrane association is important, consider using specialized membrane protein expression systems

How can RNA editing sites in ndhG transcripts be accurately identified and verified?

Based on RNA editing patterns observed in ferns and lycophytes, researchers should employ these methods to identify and verify editing sites in ndhG:

  • Transcriptome Analysis: Extract organelle-enriched RNA using methods similar to those described for ferns :

    • Homogenize 50-100g of mature tissue

    • Filter through cheesecloth and Miracloth

    • Pellet organelles by differential centrifugation (12,000 × g)

    • Isolate RNA using RNeasy Plant RNA Kit or similar

    • Reduce ribosomal RNA content using RiboMinus Plant Kit

    • Perform 75-100bp Illumina sequencing

  • Bioinformatic Analysis:

    • Map RNA-seq reads to the chloroplast genome reference

    • Identify mismatches between RNA and DNA sequences

    • Filter for C-to-U and potentially U-to-C changes

    • Validate with depth parameters (typically >10× coverage)

  • Experimental Verification:

    • Perform RT-PCR and Sanger sequencing of specific regions

    • Use multiple biological replicates to confirm consistency

    • Consider poisoned primer extension assays for quantification

Based on patterns observed in related species, editing sites often occur preferentially at second codon positions and may alter amino acid identity of the protein .

What purification strategy yields the highest activity for recombinant ndhG protein?

For optimal purification of functional recombinant ndhG:

Recommended Purification Protocol:

  • Extraction buffer selection:

    • Use buffers containing mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

    • Include protease inhibitors and reducing agents

    • Maintain pH 7.2-7.5 for optimal stability

  • Chromatography sequence:

    • Initial capture: Immobilized metal affinity chromatography (if His-tagged)

    • Intermediate purification: Ion exchange chromatography

    • Polishing step: Size exclusion chromatography

  • Activity preservation:

    • Add stabilizing agents (10% glycerol, 1mM DTT)

    • Maintain low temperature (4°C) throughout purification

    • Consider including physiological cofactors in storage buffer

Critical Parameter: Buffer detergent concentration must be optimized to solubilize the protein while maintaining the native structure required for activity.

How conserved is ndhG across lycophyte species compared to other plant lineages?

Comparative analysis between Huperzia lucidula and H. serrata chloroplast genomes provides insights into conservation patterns among lycophytes. While specific data on ndhG conservation was not directly provided in the search results, related observations include:

Conservation Patterns:

Researchers investigating ndhG should conduct specific conservation analyses with:

  • Multiple sequence alignments across plant lineages

  • dN/dS ratio calculations to assess selection pressures

  • Examination of conserved functional domains across evolutionary distance

What evolutionary insights can be gained from studying ndhG sequence variations among species?

The ndhG gene, as part of the chloroplast genome, can provide valuable evolutionary insights at multiple levels:

Research Applications:

  • Phylogenetic marker development:

    • While not among the most variable regions identified in the Huperzia comparison, ndh genes can still provide phylogenetic signal

    • Researchers should compare with highly variable regions identified between Huperzia species (rps16-chlB, ycf12-trnR, and ycf1)

  • Evolutionary rate analysis:

    • Compare substitution rates with other chloroplast genes

    • Assess selection pressures on different protein domains

    • Identify lineage-specific adaptations

  • Functional evolution correlation:

    • Map sequence changes to functional domains

    • Correlate changes with ecological adaptations

    • Identify compensatory mutations that maintain protein function

The chloroplast genome of Huperzia lucidula is particularly valuable as it represents a significant sister clade to all extant vascular plants, facilitating exploration of evolutionary relationships between lycophytes and other vascular plants .

RNA Editing and Post-Transcriptional Modifications

To characterize RNA editing in ndhG transcripts from Huperzia lucidula, researchers should employ a multi-faceted approach:

Recommended Methodology:

  • Transcriptome Analysis:

    • Isolate organelle-enriched RNA following protocols used for ferns :

      • Homogenize tissue and filter through cheesecloth/Miracloth

      • Pellet organelles by centrifugation at 12,000 × g

      • Extract RNA using commercial kits with DNase treatment

    • Perform RNA sequencing with sufficient depth (>20 million reads)

    • Map reads to the reference chloroplast genome

  • Computational Prediction:

    • Use specialized tools for predicting editing sites (PREP-Cp, PREPACT)

    • Compare with known editing sites in related species

    • Assess conservation of editing sites across lineages

  • Experimental Validation:

    • Perform RT-PCR followed by Sanger sequencing

    • Use poisoned primer extension for quantitative assessment

    • Consider HIGH-RESOLUTION MELTING analysis for rapid screening

  • Functional Assessment:

    • Express both edited and unedited protein versions

    • Compare biochemical properties and activities

    • Assess structural differences through modeling

Research should focus particularly on second codon positions, as RNA editing in coding regions preferentially occurs at these positions in ferns (54.3-63.0% of coding region edits) .

How do RNA editing patterns affect the functional characteristics of the ndhG protein?

RNA editing could significantly impact ndhG protein structure and function through multiple mechanisms:

Potential Functional Effects:

  • Amino Acid Identity Changes:

    • Based on patterns in ferns, coding region edits often change amino acid identity by modifying second codon positions

    • These changes may alter:

      • Protein stability

      • Cofactor binding affinity

      • Subunit interactions

      • Catalytic efficiency

  • Creation/Removal of Regulatory Features:

    • RNA editing could potentially create or remove:

      • Start codons (as observed in 5 genes in O. californicum)

      • Stop codons (as observed in 2 genes in O. californicum)

      • Critical motifs for protein-protein interactions

  • Expression Level Effects:

    • Editing in non-coding regions (UTRs) may impact:

      • Translation efficiency

      • mRNA stability

      • Regulatory protein binding sites

When studying recombinant ndhG, researchers should consider both genomic and potentially edited transcript sequences to ensure the protein being studied reflects the physiologically relevant form.

What protein interaction partners are essential for recombinant ndhG functionality?

The ndhG protein functions as part of the multi-subunit NDH complex in chloroplasts. For functional studies, researchers should consider:

Critical Interaction Partners:

  • Other NDH Complex Subunits:

    • Core subunits: ndhA-ndhK, encoded by both chloroplast and nuclear genomes

    • Subcomplexes: Membrane domain, hydrogenase module, and electron input module

    • Accessory proteins: Various nuclear-encoded assembly factors

  • Electron Transport Chain Components:

    • Ferredoxin (for electron input)

    • Plastoquinone (electron acceptor)

    • Potential interaction with PSI components

Methodological Approaches for Interaction Studies:

  • Co-immunoprecipitation with tagged ndhG

  • Blue-native PAGE for intact complex analysis

  • Yeast two-hybrid or split-ubiquitin assays for binary interactions

  • Proximity-based labeling (BioID) to identify interaction network

When expressing recombinant ndhG alone, researchers should be aware that full functionality may require reconstitution with partner proteins.

How can researchers effectively measure enzymatic activity of recombinant ndhG in isolation versus as part of the NDH complex?

Assessing enzymatic activity requires different approaches depending on whether ndhG is studied in isolation or within the complex:

For Isolated ndhG Protein:

  • Binding Assays:

    • Measure affinity for known cofactors and substrates

    • Isothermal titration calorimetry

    • Surface plasmon resonance

    • Microscale thermophoresis

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy

    • Thermal shift assays

    • Limited proteolysis

For Reconstituted NDH Complex:

  • Electron Transport Activity:

    • Spectrophotometric monitoring of NAD(P)H oxidation

    • Oxygen consumption measurements

    • Artificial electron acceptor (ferricyanide) reduction

  • Proton Translocation:

    • pH-sensitive fluorescent dyes in proteoliposomes

    • Ion-selective electrodes

Comparative Assessment:

What are the most common expression challenges with recombinant ndhG and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant ndhG:

Common Challenges and Solutions:

ChallengeCauseSolution
Poor expression levelsCodon bias, toxicityOptimize codons, use tightly controlled inducible promoters
Inclusion body formationImproper folding, hydrophobicityLower expression temperature (16-20°C), use solubility tags (SUMO, MBP)
DegradationProtease sensitivityInclude protease inhibitors, use protease-deficient strains
Loss of cofactorsPurification conditionsSupplement buffers with appropriate cofactors
Aggregation post-purificationImproper buffer conditionsOptimize buffer components (salt, pH, additives)

Special Considerations:

  • If membrane association is important, consider using detergent micelles or nanodiscs

  • For complex formation studies, co-expression with partner proteins may improve solubility

  • Cell-free expression systems may offer advantages for difficult-to-express proteins

How can researchers distinguish between native ndhG function and artifacts in experimental systems?

To ensure experimental observations reflect physiologically relevant ndhG function:

Validation Strategies:

  • Multiple Expression Systems:

    • Compare results between prokaryotic and eukaryotic hosts

    • Use both in vitro and in vivo assessment methods

    • Include appropriate negative controls (inactive mutants)

  • Complementation Studies:

    • Test functionality by complementing ndh-deficient mutants

    • Assess restoration of phenotypes under stress conditions

    • Measure physiological parameters (photosynthetic efficiency)

  • Structure-Function Validation:

    • Generate site-directed mutants of conserved residues

    • Correlate activity loss with structural changes

    • Compare with homologous proteins from other species

  • Native vs. Recombinant Comparison:

    • When possible, isolate native complexes for direct comparison

    • Account for post-translational modifications and RNA editing

    • Consider tissue-specific variations in activity

What innovative approaches can address the challenges of studying membrane-associated proteins like ndhG?

Membrane-associated proteins present unique research challenges requiring specialized techniques:

Innovative Methodological Approaches:

  • Membrane Mimetic Systems:

    • Nanodiscs for controlled lipid environment

    • Styrene-maleic acid lipid particles (SMALPs) for native lipid preservation

    • GRASPs (Glycolipid Replacement Amphipathic Surface Proteins) for stability

  • Advanced Structural Biology:

    • Cryo-electron microscopy of intact complexes

    • Solid-state NMR for membrane-embedded domains

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • In silico Integration:

    • Molecular dynamics simulations in membrane environments

    • Machine learning prediction of membrane interactions

    • Integrative modeling combining multiple experimental datasets

  • Single-Molecule Techniques:

    • Atomic force microscopy for topography and mechanics

    • Single-molecule FRET for conformational changes

    • Optical tweezers for energy landscape mapping

These innovative approaches can provide insights into ndhG function within membranes that would be difficult to obtain through conventional biochemical methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.