Recombinant Huperzia lucidula Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Huperzia lucidula Photosystem I Assembly Protein Ycf4 (ycf4)

Recombinant Huperzia lucidula Photosystem I (PSI) assembly protein Ycf4 (ycf4) is a protein crucial for the accumulation of PSI, a large protein-pigment complex embedded in photosynthetic membranes of chloroplasts and cyanobacteria, in Chlamydomonas reinhardtii . PSI functions as a transmembrane electron conductor, transferring electrons from plastocyanin to ferredoxin, which provides the reducing power needed for carbon fixation . Ycf4 is a thylakoid protein, meaning it is located in the thylakoid membranes within the chloroplast .

Function and Role of Ycf4 in Photosystem I Assembly

Ycf4 plays a pivotal role in the assembly of PSI by mediating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex . It acts as a nonessential assembly factor for PSI in higher plants . The protein is part of a large complex and interacts with other biomolecules .

  • Scaffolding Role: Ycf4 may act as a scaffold for PSI assembly .

  • Regulatory Checkpoint: Research indicates that PsaF, another PSI subunit, acts as a regulatory checkpoint that promotes the assembly of LHCI (light-harvesting complex I), effectively coupling biogenesis to function .

Interactions with Other Proteins

Ycf4 interacts with other proteins, such as Ycf3 and Y3IP1, to mediate PSI assembly .

  • Ycf3 and Y3IP1: Ycf3 and Y3IP1 form modules that facilitate the assembly of reaction center subunits. Mutants lacking Ycf3 still accumulate Ycf4 and the PSI core protein PSAF at wild-type levels .

  • PsaA and PsaD: Ycf3 interacts directly with the PSI subunits PsaA and PsaD, but not with subunits from other photosynthetic complexes, suggesting that Ycf3 acts as a chaperone during the assembly of the PSI complex .

Experimental Techniques and Methods

Various experimental techniques have been employed to study Ycf4, including:

  • Tandem Affinity Purification (TAP): Used to purify the Ycf4-containing complex .

  • Mass Spectrometry: Used to identify the protein components of the purified complex .

  • Immunoblotting: Used to confirm the presence and levels of specific proteins .

  • Electron Microscopy: Used to visualize the purified complex .

  • Pulse-Chase Protein Labeling: Used to study the assembly of newly synthesized PSI polypeptides .

  • Site-Directed Mutagenesis: Employed to generate specific mutations in Ycf3 to study its function .

  • Fluorescence Induction Kinetics: Used to measure PSI activity in mutant strains .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
ycf4
Target Protein Sequence
MNWQSEWLRVEPIMGSRRISNFCWACITSLGALGFFLVGIPSYLGKDLIPVLPSQQIVFV PQGIVMCFYGIAGLFPSFYLWCTILWNVGSGYNIFDKREGIICLFRWGFPGENRRICIRF SMKDIQAIRVEVREAISPRRVLHMKVKGQQDVPLTRISENLTLREMEEKAAELARFLHVS MEGP
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its fundamental role in photosynthesis?

Ycf4 (hypothetical chloroplast reading frame no. 4) is a thylakoid membrane protein essential for the assembly and accumulation of the photosystem I (PSI) complex. It functions as a critical assembly factor that enables the stable formation of PSI.

Research findings demonstrate that Ycf4 is involved in the stabilization of the PSI complex rather than in its translation or transcription. Western blot analyses have confirmed that while Ycf4 is not stably associated with the PSI complex itself, it is required for PSI subunits to properly accumulate in thylakoid membranes . The protein interacts with other assembly factors in a coordinated process to facilitate the construction of the PSI reaction center .

The significance of Ycf4 varies across photosynthetic organisms:

OrganismYcf4 RequirementPhotosynthetic Phenotype Without Ycf4
Chlamydomonas reinhardtiiEssentialUnable to grow photoautotrophically
Nicotiana tabacum (tobacco)Non-essential but importantSeverely impaired photosynthesis but capable of photoautotrophic growth under low light
CyanobacteriaNon-essentialPSI complex assembles at reduced levels

This variable dependency suggests evolutionary adaptations in the PSI assembly mechanisms across different photosynthetic lineages.

What experimental methods are commonly employed to study Ycf4 function?

Several complementary experimental approaches have been developed to investigate Ycf4 function:

Experimental ApproachMethodologyResearch Applications
Gene disruption/knockoutBiolistic transformation with selectable markers (e.g., aadA cassette)Evaluating phenotypic consequences of Ycf4 absence
Affinity purificationTAP-tagged Ycf4 with IgG agarose chromatographyIsolating Ycf4-containing complexes and identifying interaction partners
Fluorescence analysisFluorescence induction kinetics in dark-adapted cellsAssessing PSI activity in wild-type vs. mutant lines
Protein localizationFractionation followed by immunoblot analysisDetermining subcellular localization and membrane association
Growth phenotypingComparative growth on different media and light conditionsCharacterizing photoautotrophic vs. mixotrophic capabilities
Photosynthetic parameter analysisMeasuring chlorophyll content, chlorophyll a/b ratio, PSII efficiencyQuantifying photosynthetic performance
Electron microscopyTransmission electron microscopy and single particle analysisVisualizing purified Ycf4-containing complexes

For affinity purification specifically, two-step column chromatography has proven effective. In studies using TAP-tagged Ycf4, researchers found that adsorption of the tagged protein to IgG agarose required extended incubation (overnight at 4°C) in a rotating column, as the binding was not efficient with standard flow-through methods .

How conserved is Ycf4 across different photosynthetic organisms?

Ycf4 displays moderate sequence conservation across photosynthetic organisms. Comparative analyses reveal that the deduced amino acid sequence of Ycf4 from Chlamydomonas reinhardtii (197 residues) shares 41-52% sequence identity with homologues from other algae, land plants, and cyanobacteria . This level of conservation suggests a preserved functional role despite considerable sequence divergence.

The ycf4 gene is consistently encoded in the chloroplast genome across photosynthetic lineages. Genomic analyses of Ophioglossum californicum, Huperzia lucidula, and other plants confirm the presence of ycf4 in the plastid genome . The gene organization surrounding ycf4 varies somewhat between species, but in Chlamydomonas reinhardtii, ycf4 and ycf3 are co-transcribed as members of the rps9–ycf4–ycf3–rps18 polycistronic transcriptional unit .

Despite sequence conservation, the functional dependency on Ycf4 varies significantly across photosynthetic organisms, with some requiring it absolutely for photosynthesis (C. reinhardtii) while others maintain partial function in its absence (cyanobacteria, tobacco) .

What is the composition of the Ycf4-containing protein complex?

The Ycf4-containing complex is a large molecular assembly exceeding 1500 kD. Biochemical purification and characterization of this complex has revealed its composition through several complementary techniques including N-terminal amino acid sequencing, immunoblot analysis, and mass spectrometry .

Key components of the Ycf4 complex include:

  • Ycf4 protein itself, serving as a scaffold/stabilization factor

  • A retinal binding protein identified as COP2

  • Several PSI polypeptides that appear to be assembled into an intermediate assembly subcomplex

The complex likely represents a transitional assembly state in PSI biogenesis rather than a stable end-product. Electron microscopy visualization and single particle analysis have provided structural insights into this assembly intermediate .

In the broader context of PSI assembly, Ycf4 functions as part of a coordinated network involving multiple auxiliary factors:

Auxiliary FactorProposed Function in PSI Assembly
Ycf3Assists initial assembly of newly synthesized PsaA/B subunits into an RC subcomplex
Y3IP1/CGL59Transfers the RC subcomplex from Ycf3 to the Ycf4 module
Ycf4Stabilizes the RC subcomplex
Ycf37/PYG7/CGL71Forms an oligomer that transiently protects the PSI RC subcomplex under oxic conditions

These factors work together in a stepwise manner to facilitate the assembly of the PSI reaction center, with each playing a distinct role in the process .

How does the knockout of Ycf4 affect photosynthetic efficiency in different organisms?

The impact of Ycf4 knockout exhibits striking variation across photosynthetic organisms, revealing evolutionary differences in PSI assembly mechanisms:

OrganismPhotosynthetic ImpactGrowth PhenotypeMolecular Consequences
Chlamydomonas reinhardtiiComplete loss of PSI activityUnable to grow photoautotrophically; growth severely impaired even in mixotrophic conditionsPSI complex fails to accumulate in thylakoid membranes
Nicotiana tabacum (tobacco)Severely reduced photosynthetic performance but not eliminatedCan grow photoautotrophically under low light (40–50 µE m⁻² s⁻¹); extreme sensitivity to higher light; retarded growth and developmentReduced chlorophyll content; decreased chlorophyll a/b ratio; lower PSII quantum efficiency
CyanobacteriaPartial reduction in PSI activityNot fully characterizedPSI complex assembles but at reduced levels

In tobacco Δycf4 knockout plants, detailed physiological measurements revealed:

  • Significant reduction in chlorophyll content (approximately 50% of wild-type levels)

  • Decreased chlorophyll a/b ratio, suggesting a deficiency in photosystem cores relative to antenna complexes

  • Reduced maximum quantum efficiency of PSII (Fv/Fm values significantly lower than wild-type)

  • Extreme light sensitivity, unable to grow at light intensities >80 µE m⁻² s⁻¹

These differences highlight the evolutionary divergence in PSI assembly pathways and suggest that higher plants have developed alternative or redundant mechanisms for PSI assembly that can partially compensate for the absence of Ycf4.

What is the precise localization of Ycf4 within the chloroplast?

Treatment of thylakoid membranes with alkaline solutions or chaotropic agents resulted in the release of Ycf4 from the membrane, establishing it as an extrinsic membrane protein rather than an integral one . This peripheral association suggests that Ycf4 interacts with the thylakoid membrane through electrostatic or hydrophobic interactions rather than through membrane-spanning domains.

Importantly, Ycf4 is not stably associated with the mature PSI complex. It accumulates to wild-type levels in mutants lacking PSI, indicating that its presence is independent of the complex it helps assemble . This finding supports its role as an assembly factor rather than a structural component of the final PSI complex.

How do Ycf4 transcript and protein levels respond to photosynthetic perturbations?

RNA blot hybridization experiments have demonstrated that transcripts of PSI components (psaA, psaB, and psaC) accumulate normally in Ycf4-deficient mutants . This indicates that Ycf4 does not regulate the transcription or stability of PSI component transcripts.

The Ycf4 protein itself shows interesting regulatory patterns:

  • Ycf4 accumulates to wild-type levels in mutants lacking PSI, PSII, or the cytochrome b₆/f complex

  • Its expression appears to be independent of the presence of the complexes it helps assemble

  • In TAP-tagged strains where Ycf4 accumulation was reduced by 75%, PSI complex assembly remained unaffected, suggesting that Ycf4 is not a limiting factor in PSI assembly under normal conditions

This evidence collectively indicates that Ycf4 functions catalytically rather than stoichiometrically in PSI assembly, with even reduced levels sufficient to support normal PSI biogenesis.

What is the step-by-step mechanism of Ycf4's role in PSI assembly?

Recent research has revealed a coordinated, multi-factor process for PSI assembly in which Ycf4 plays a specific role. The current model, based on biochemical and structural studies, proposes the following sequence:

  • Initial assembly phase: Ycf3 assists the initial assembly of newly synthesized PsaA/B subunits into a reaction center (RC) subcomplex.

  • Transfer phase: Y3IP1/CGL59 facilitates the transfer of the nascent RC subcomplex from Ycf3 to the Ycf4 module.

  • Stabilization phase: The Ycf4 module stabilizes the RC subcomplex, potentially providing a protected environment for proper folding and cofactor incorporation.

  • Protection phase: CGL71 forms an oligomer that transiently interacts with the PSI RC subcomplex, physically protecting it under oxic conditions.

  • Completion phase: The protected and stabilized RC subcomplex associates with the peripheral PSI subunits to form the complete PSI complex .

This model explains why disruption of Ycf4 prevents stable accumulation of PSI complexes while not affecting transcription or translation of PSI components. The lack of Ycf4 disrupts a critical stabilization step in the assembly pathway, resulting in degradation of incompletely assembled intermediates.

What experimental approaches can determine protein-protein interactions involving Ycf4?

Several complementary techniques have proven valuable for investigating Ycf4's interactions with other proteins:

When implementing these approaches, researchers should consider:

  • The detergent used for membrane solubilization significantly impacts complex integrity

  • The optimal approach may combine multiple techniques for cross-validation

  • Control experiments with unrelated proteins are essential to distinguish specific from non-specific interactions

Researchers have found that solubilization of thylakoid membranes with n-dodecyl-β-D-maltoside (DDM) followed by extended incubation with IgG agarose effectively captures Ycf4-containing complexes .

What are the differences in Ycf4 dependency across evolutionary lineages?

The variable requirements for Ycf4 across different photosynthetic organisms provide insights into the evolution of photosynthetic assembly mechanisms:

Evolutionary LineageYcf4 RequirementEvidenceEvolutionary Implications
Green algae (C. reinhardtii)Absolute requirementKnockout mutants unable to grow photoautotrophically Represents ancestral dependency pattern
CyanobacteriaPartial requirementReduced but not eliminated PSI assembly Suggests alternative/redundant assembly pathways
Higher plants (N. tabacum)Important but not essentialSeverely impaired but not eliminated photoautotrophy Indicates evolved compensatory mechanisms

These differences suggest an evolutionary trajectory in which alternative PSI assembly pathways emerged, reducing absolute dependency on Ycf4. This may represent an adaptation to increase the robustness of the photosynthetic apparatus against genetic perturbations.

The conservation of Ycf4 across all photosynthetic lineages despite this reduced dependency indicates that it likely provides optimal efficiency in PSI assembly even when not absolutely required. This pattern of retained but variable dependency is consistent with the "backup circuit" hypothesis in evolutionary biology, where redundant systems evolve to ensure critical functions.

How can recombinant Huperzia lucidula Ycf4 be utilized for in vitro reconstitution studies?

The availability of recombinant Huperzia lucidula Photosystem I assembly protein Ycf4 opens possibilities for in vitro reconstitution approaches to study PSI assembly mechanisms . Researchers can implement the following methodological approaches:

  • Protein-protein interaction assays: Using purified recombinant Ycf4 to identify direct binding partners through pull-down assays or surface plasmon resonance.

  • In vitro assembly systems: Developing reconstitution systems where purified components (including Ycf4, PSI subunits, and other assembly factors) are combined under controlled conditions to monitor assembly intermediates.

  • Structure-function studies: Introducing site-directed mutations in recombinant Ycf4 to identify critical residues for function and interaction with PSI components.

  • Cross-species complementation: Testing whether recombinant H. lucidula Ycf4 can rescue assembly defects in Ycf4-deficient mutants from other species.

For optimal reconstitution experiments, researchers should consider:

  • Buffer conditions that mimic the thylakoid environment (pH, salt concentration)

  • Addition of lipids to provide a membrane-like environment

  • Controlled incorporation of chlorophyll and other cofactors

  • Sequential addition of components to recapitulate the natural assembly sequence

While technically challenging, such in vitro approaches could provide unprecedented insights into the molecular mechanisms of PSI assembly that cannot be obtained through in vivo studies alone.

What are the key unresolved questions about Ycf4 function?

Despite significant progress in understanding Ycf4's role in PSI assembly, several important questions remain unresolved:

  • The precise molecular mechanism by which Ycf4 stabilizes the PSI reaction center subcomplex

  • The structural basis for Ycf4's interaction with other assembly factors and PSI components

  • The regulatory mechanisms controlling Ycf4 activity under different environmental conditions

  • The evolutionary basis for the variable dependency on Ycf4 across photosynthetic lineages

  • The detailed composition and structure of assembly intermediates containing Ycf4

Addressing these questions will require integrated approaches combining structural biology, biochemistry, and genetic manipulation. As new techniques like cryo-electron microscopy continue to advance, detailed structural insights into Ycf4-containing complexes may soon become available, potentially transforming our understanding of this critical assembly factor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.