Recombinant Huperzia lucidula Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is typically expressed in E. coli systems with N-terminal His-tags for affinity purification . Commercial vendors optimize yields using Tris/PBS-based buffers with glycerol or trehalose for stability .

Production Metrics:

ParameterSpecification
Expression HostE. coli
Purity>85–90% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water + glycerol

Comparative Genomic Analysis

The psbB gene in H. lucidula exhibits evolutionary conservation with other lycophytes. A comparative analysis of chloroplast genomes highlights distinct features :

Chloroplast Genome Features:

FeatureH. lucidulaH. serrata
Total Size (bp)154,373154,176
LSC Region (bp)104,088104,080
SSC Region (bp)19,65719,658
GC Content (%)36.336.3
Protein-Coding Genes8686

Notably, H. lucidula lacks the trnI-GAU and ycf66 intron found in H. serrata, suggesting lineage-specific adaptations .

Applications in Photosynthesis Research

  1. Mechanistic Studies: Used to probe chlorophyll-protein interactions and PSII repair cycles under photodamage .

  2. Evolutionary Biology: Serves as a molecular marker for studying chloroplast genome rearrangements in lycophytes .

  3. Biotechnology: Templates for engineering synthetic light-harvesting complexes .

Limitations and Future Directions

While the recombinant protein replicates structural features, it does not natively bind chlorophylls or xanthophylls, limiting functional studies in vitro . Future work could focus on co-expressing chaperones or utilizing eukaryotic expression systems to improve pigment incorporation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGL FVVPFMTRLGITKSWGGWSITGETVNDAGVWSYEGVAAAHIVLSGLFFLAAIWHWVFWDL DLFRDPRTGKPTLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGIWVSDPYGLTGKVQP VAPVWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIDRRIRSSRAENLSLSE AWSEIPQKLAFYDYIGNNPAKGGLFRAGPMDNGDGIAVGWLGHAVFKDKEGHELFVRRMP TLFETFPVVLADGEGIVRADVPFRRAESKYSIEQVGVTVEFYGGELDGVSFSDPATVKKY ARRAQLGEIFESDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDSDAQVEFGTFQKLGDPTTRRPVV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein) is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.