Recombinant Huperzia lucidula Photosystem II reaction center protein Z (psbZ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Huperzia lucidula Photosystem II Reaction Center Protein Z (psbZ)

The recombinant Huperzia lucidula Photosystem II reaction center protein Z (psbZ) is a full-length, His-tagged protein derived from the club moss Huperzia lucidula. Expressed in E. coli, this protein corresponds to the UniProt accession Q5SD09 and is part of the Photosystem II (PSII) complex, critical for light-driven water oxidation in photosynthesis .

Expression and Purification

ParameterSpecification
SourceEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in deionized sterile water; add 5–50% glycerol for long-term storage

Table 1: Key Specifications of Recombinant psbZ

Functional Role in Photosynthesis

psbZ is a low-molecular-weight subunit of the PSII core complex, contributing to the stability and assembly of light-harvesting and reaction center components. In Huperzia lucidula, the psbZ gene is part of the plastid genome, which exhibits minimal structural rearrangements compared to ancestral land plants . The plastome retains collinearity with nonvascular plants, suggesting evolutionary conservation of psbZ’s genomic context .

Comparative Genomic Context

In lycophytes like H. lucidula, plastome evolution involves minor IR expansions capturing genes such as ndhF and rps12, but psbZ remains in its conserved position within the large single-copy (LSC) region . This contrasts with Selaginella and Isoetes, where plastome rearrangements are more pronounced .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Synonyms
psbZ; Photosystem II reaction center protein Z; PSII-Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-62
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
psbZ
Target Protein Sequence
MTIAFQLAVFASIAIPFILVIGVPVVLASPDGWSSSRNVVFSGASSWIGLVFLVGILNSL IS
Uniprot No.

Target Background

Function
This protein regulates the interaction of photosystem II (PSII) cores with the light-harvesting antenna.
Protein Families
PsbZ family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.