Recombinant Huperzia lucidula Photosystem Q (B) protein (psbA)
Shipped with Ice Packs 
In Stock 
Description
Applications in Research
The recombinant Huperzia lucidula psbA protein serves as a tool for:
-
Biochemical Studies:
-
Structural analysis of PSII complexes.
-
Functional assays to study quinone binding and electron transfer.
-
-
Diagnostic Assays:
-
Evolutionary Research:
Evolutionary Context
The psbA gene is part of the conserved plastid genome architecture in land plants. In lycophytes like Huperzia, the plastid genome retains a quadripartite structure with IRs, though IR expansions in ferns and angiosperms have led to gene duplications (e.g., rps19-rpl2-rpl23-ndhB-rps7-rps12 blocks) . Huperzia’s plastid genome lacks such duplications, preserving ancestral gene arrangements .
Comparative Genomic Features
Product Specs
Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, kindly indicate them in your order notes, and we will prepare accordingly.
Please note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, kindly indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing it according to your specification.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Huperzia lucidula (Shining clubmoss) (Lycopodium lucidulum)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWGRFCDWVTSTENRLYIGWFGVLMIPTLLTATAVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.
Target Background
Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
