Recombinant Hydrogenobaculum sp. NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Hydrogenobaculum sp.?

NADH-quinone oxidoreductase subunit K (nuoK) in Hydrogenobaculum sp. is a small membrane protein that forms part of the bacterial NADH-quinone oxidoreductase complex (NDH-1), which is homologous to the mitochondrial complex I. The nuoK subunit from Hydrogenobaculum sp. strain Y04AAS1 consists of 110 amino acids with the sequence: MIETIASKLLVQNVSQYFILSFILLGIGLFGMMVRKNLITILMSLELALNSVNIAFVGIDRLNHLIDGEIFALFTIALAAAEAAVGLGIILSLFRLRKAENVNEIIDLKG . This subunit is functionally similar to the mitochondrial ND4L subunit and plays a crucial role in the electron transport and proton translocation mechanisms of the respiratory chain . The protein is predominantly hydrophobic, containing transmembrane domains that anchor it within the bacterial inner membrane.

How does nuoK contribute to the NADH-quinone oxidoreductase function?

The nuoK subunit occupies a strategic position in the membrane domain of NADH-quinone oxidoreductase and contributes to the enzyme's function through several mechanisms:

• Proton translocation: Conserved charged residues in nuoK, particularly glutamic acid residues (analogous to Glu-36 and Glu-72 in E. coli), are essential for the proton-pumping activity of the enzyme . Mutations in these residues lead to significant reduction in coupled electron transfer and loss of electrochemical gradient generation.

• Structural integrity: Despite its small size, nuoK plays a critical role in maintaining the structural integrity of the NDH-1 complex. Research demonstrates that even with point mutations in conserved residues, the NDH-1 complex remains assembled as detected by blue-native gel electrophoresis and immunostaining .

• Coupling mechanism: The nuoK subunit participates in coupling electron transfer from NADH to quinone with proton translocation across the membrane. This coupling is essential for energy conservation in the form of proton-motive force that drives ATP synthesis .

Methodologically, the contribution of nuoK can be studied through site-directed mutagenesis of conserved residues followed by functional assays measuring NADH oxidation rates and membrane potential generation.

What distinguishes Type I and Type II NADH:quinone oxidoreductases?

Type I NADH:quinone oxidoreductase (NDH-1) is a large, multi-subunit complex that couples the two-electron transfer from NADH to quinone with proton translocation across the membrane, thereby contributing to the generation of proton-motive force. In contrast, Type II NADH:quinone oxidoreductase (NDH-2) catalyzes the same redox reaction but without energy transduction . NDH-2 accomplishes the turnover of NAD(P)H, regenerating NAD(P)+ without contributing directly to energy conservation. Some organisms exclusively rely on NDH-2 for NADH oxidation, highlighting its essential role in maintaining the [NADH]/[NAD+] balance in bacterial physiology .

How can site-directed mutagenesis be used to investigate conserved residues in nuoK?

Site-directed mutagenesis represents a powerful approach to investigate the functional importance of conserved residues in nuoK. The methodology involves:

• Target selection: Identify highly conserved residues using multiple sequence alignments across bacterial species. For nuoK, particular attention should be given to charged residues like glutamic acids and arginines, which may participate in proton translocation or protein-protein interactions .

• Mutagenesis strategy:

  • Design primers for PCR-based site-directed mutagenesis of the nuoK gene

  • Use homologous recombination techniques to integrate mutations into the genome

  • Verify mutations by DNA sequencing

• Functional characterization:

  • Assess assembly of the NDH-1 complex using blue-native gel electrophoresis and immunostaining

  • Measure NADH:quinone oxidoreductase activity using spectrophotometric assays

  • Evaluate proton-pumping ability using pH indicators or membrane potential-sensitive dyes

  • Determine growth phenotypes under different respiratory conditions

Previous studies with E. coli nuoK have shown that mutations of highly conserved glutamic acid residues (Glu-36 and Glu-72) led to almost complete loss of coupled electron transfer activity and proton-pumping ability, while the enzyme complex remained fully assembled . This methodological approach revealed that these membrane-embedded acidic residues are critical for the coupling mechanism rather than structural integrity.

For Hydrogenobaculum sp. nuoK, comparable residues should be targeted, with additional focus on amino acids unique to extremophilic bacteria that might contribute to their adaptation to harsh environments.

What genomic adaptations are observed in the nuoK gene of Hydrogenobaculum sp. from different geothermal environments?

Comparative genomic analysis of Hydrogenobaculum isolates from different geothermal features in Yellowstone National Park reveals intriguing adaptations in respiratory chain components, including nuoK. Methodological approaches to identify these adaptations include:

• Whole genome sequencing and comparison: Complete genome sequences of Hydrogenobaculum isolates from Dragon Spring (DS) and strain Y04AAS1 from an ephemeral stream connecting Figure 8 pool and Obsidian Pool-Prime show that despite phylogenetic relatedness, they represent different ecotypes .

• Synteny analysis: Using tools like the Artemis Comparison Tool to align and visualize gene arrangements across genomes, revealing conservation or rearrangements in the NADH-quinone oxidoreductase operon .

• Average nucleotide identity (ANI) and percentage conserved DNA (PCD) calculations: These metrics quantify genome-wide similarity and can be applied specifically to the nuoK region to assess conservation .

• Microdiversity analysis: DS isolates exhibit limited 16S rRNA gene sequence deviation (≥99.7% identity) but differ from Y04AAS1 by 10-15 nucleotides (99.30% to 98.96%) . Similar microdiversity patterns may be observed in the nuoK gene.

• Environmental correlation: Linking genetic variations to specific environmental parameters such as pH, temperature, and available electron donors/acceptors.

The genomic adaptations observed in Hydrogenobaculum sp. nuoK likely reflect selective pressures from their respective geothermal habitats. For instance, DS environments contain millimolar levels of sulfate, chloride, and CO2, with significant H2 and H2S that serve as electron donors . These conditions may select for specific amino acid substitutions in nuoK that optimize electron transport under these extreme conditions.

How does the structural arrangement of nuoK contribute to proton translocation in NDH-1?

The structural arrangement of nuoK within the membrane domain of NDH-1 is critical for its role in proton translocation. Analysis of this relationship requires multiple methodological approaches:

• Structural prediction and modeling:

  • Homology modeling based on resolved structures of bacterial and mitochondrial complex I

  • Molecular dynamics simulations to predict conformational changes during the catalytic cycle

  • Identification of potential proton pathways through the membrane domain

• Mutational analysis of key residues:
  The NuoK subunit contains highly conserved glutamic acid residues that appear to be located in the middle of the membrane. Mutations of these residues (Glu-36 and Glu-72 in E. coli) lead to almost complete loss of coupled electron transfer activity and proton-pumping ability . These residues likely form part of the proton translocation pathway.

• Conformational coupling analysis:
  Studies on related systems like Na+-pumping NADH:ubiquinone oxidoreductase (Na+-NQR) have shown that conserved glycine residues (Gly-140 and Gly-141) control conformational changes necessary for quinone reduction . Similar flexible glycine residues may exist in nuoK to facilitate conformational changes during the catalytic cycle.

• Cross-linking and interaction studies:
  Chemical cross-linking followed by mass spectrometry can identify proximity relationships between nuoK and other subunits of the NDH-1 complex, revealing how nuoK is positioned within the proton-translocation machinery.

The membrane-embedded acidic residues in nuoK likely participate directly in proton transfer, while conserved arginine residues on cytosolic loops may be involved in conformational changes necessary for coupling electron transfer to proton translocation .

What are the challenges and solutions in expressing functional recombinant nuoK protein?

Expressing and purifying functional recombinant nuoK protein presents several challenges due to its hydrophobic nature and small size. Methodological solutions include:

• Expression challenges and solutions:

  • Challenge: Membrane protein toxicity to host cells

  • Solution: Use of tightly regulated expression systems (e.g., T7 promoter with lac operator) and specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

  • Challenge: Improper membrane insertion

  • Solution: Inclusion of appropriate signal sequences or fusion partners (e.g., maltose-binding protein) to facilitate membrane targeting

• Purification strategies:

  • Challenge: Low expression yields

  • Solution: Optimization of induction conditions (temperature, inducer concentration, duration) and use of His-tag or other affinity tags for efficient purification

  • Challenge: Detergent selection for extraction

  • Solution: Screening of multiple detergents (DDM, LMNG, CHAPS) for optimal extraction while maintaining protein functionality

• Functional validation:

  • Challenge: Assessing functionality of isolated nuoK

  • Solution: Reconstitution into proteoliposomes and measuring proton translocation using pH-sensitive fluorescent dyes

  • Challenge: Structural integrity verification

  • Solution: Circular dichroism spectroscopy to confirm secondary structure content and thermal stability

• Storage and stability:
  According to commercial sources, recombinant Hydrogenobaculum sp. nuoK protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

How can functional studies of nuoK inform bioenergetic adaptations in extremophiles?

Functional studies of nuoK from Hydrogenobaculum sp. can provide valuable insights into bioenergetic adaptations that allow these extremophiles to thrive in harsh environments. Methodological approaches include:

Hydrogenobaculum sp. inhabits acidic hot springs with temperatures ranging from 55-80°C and pH values around 3.1 . The nuoK subunit and the entire NDH-1 complex must function efficiently under these extreme conditions, suggesting unique adaptations in amino acid composition, protein stability, and proton-handling mechanisms. Understanding these adaptations could provide insights into the evolution of bioenergetic systems and inspire biomimetic approaches for designing robust bioelectrochemical systems.

What spectroscopic techniques are most useful for studying electron transfer in nuoK-containing complexes?

Several spectroscopic techniques provide valuable insights into electron transfer processes involving nuoK-containing NADH:quinone oxidoreductase complexes:

• UV-visible spectroscopy:

  • Monitors NADH oxidation at 340 nm

  • Follows quinone reduction by absorbance changes

  • Provides real-time kinetic data for electron transfer rates

• Electron Paramagnetic Resonance (EPR) spectroscopy:

  • Detects paramagnetic species including iron-sulfur clusters and semiquinone intermediates

  • Identifies redox-active centers involved in electron transfer pathway

  • Can be used with freeze-quench techniques to trap intermediates

• Fluorescence spectroscopy:

  • Measures NADH binding and oxidation through intrinsic fluorescence

  • Can be coupled with pH-sensitive or membrane potential-sensitive dyes to monitor proton translocation

  • Time-resolved fluorescence can track conformational changes during catalysis

• Fourier Transform Infrared (FTIR) spectroscopy:

  • Detects conformational changes associated with ubiquinone binding

  • Studies by Strickland et al. on Na+-NQR showed that mutations in conserved glycine residues prevented conformational changes involved in ubiquinone binding but did not modify signals corresponding to bound ubiquinone

  • Electrochemically induced FTIR difference spectroscopy can monitor redox-linked structural changes

• Resonance Raman spectroscopy:

  • Provides selective enhancement of chromophores involved in electron transfer

  • Can detect subtle changes in the environment of cofactors during catalysis

These techniques, when applied to nuoK mutants or under varying conditions, can reveal how specific residues contribute to electron transfer and proton translocation mechanisms in Hydrogenobaculum sp. NADH-quinone oxidoreductase.

How can genomic context analysis help understand the evolution of nuoK in Hydrogenobaculum species?

Genomic context analysis provides valuable insights into the evolution and functional relationships of nuoK in Hydrogenobaculum species through several methodological approaches:

• Operon structure analysis:

  • Examine the organization of the nuo operon in different Hydrogenobaculum strains

  • Compare with other bacterial species to identify conserved gene arrangements

  • Detect potential horizontal gene transfer events or gene rearrangements

• Comparative genomic methods:

  • Use MAUVE software for genome-wide alignment and detection of single nucleotide polymorphisms between Hydrogenobaculum strains

  • Calculate Average Nucleotide Identity (ANI) and Percentage Conserved DNA (PCD) to quantify genomic similarity

  • Apply fragment recruitment analysis to compare genomes to metagenomes from environmental samples

• Phylogenetic analysis:

  • Construct phylogenetic trees based on nuoK sequences from different species

  • Compare with trees based on 16S rRNA genes or whole-genome data

  • Identify instances of gene duplication, loss, or lateral transfer

• Selective pressure analysis:

  • Calculate dN/dS ratios to detect signs of purifying or positive selection

  • Identify conserved residues under strong selective constraints

  • Locate rapidly evolving regions that might reflect adaptation to specific environmental conditions

Hydrogenobaculum isolates from Dragon Spring (DS) share high 16S rRNA gene sequence identity (≥99.7%) but differ from strain Y04AAS1 by 10-15 nucleotides (99.30% to 98.96%) . This phylogenetic relationship likely extends to nuoK and other respiratory chain components, reflecting adaptation to specific geochemical conditions in their respective habitats. For example, DS environments contain millimolar levels of sulfate, chloride, and CO2, along with H2 and H2S as electron donors , potentially selecting for specific adaptations in the respiratory chain.

How might understanding nuoK function contribute to bioelectrochemical applications?

Understanding the structure-function relationship of nuoK in NADH-quinone oxidoreductase provides several avenues for bioelectrochemical applications:

• Biofuel cell development:

  • Design of thermostable and acid-tolerant enzyme electrodes based on Hydrogenobaculum nuoK-containing complexes

  • Integration of modified respiratory chain components into engineered biocatalysts for improved electron transfer to electrodes

  • Exploitation of the proton-pumping capability for coupling electricity generation with proton gradient formation

• Biosensor engineering:

  • Development of NADH/NAD+ ratio sensors for monitoring cellular metabolic state

  • Creation of whole-cell biosensors for detecting electron donors or acceptors based on respiratory chain activity

  • Integration of modified nuoK proteins into electrochemical detection systems for environmental monitoring

• Biomimetic catalyst design:

  • Identification of key structural features responsible for efficient electron transfer in extreme conditions

  • Design of synthetic catalysts that mimic the electron transfer properties of NDH-1

  • Engineering of artificial proton pumps based on the mechanistic insights from nuoK function

• Metabolic engineering applications:

  • Optimization of electron transport chain components for enhanced bioproduction

  • Engineering of alternative respiratory pathways in industrial microorganisms

  • Improvement of energy conservation efficiency in biotechnological processes

The adaptation of Hydrogenobaculum nuoK to extreme conditions (high temperature, low pH) makes it particularly valuable as a template for designing robust bioelectrochemical systems capable of operating under harsh industrial conditions or in specialized applications where conventional enzymes would be unsuitable.

What are the most promising future research directions for nuoK structural biology?

Future research directions for nuoK structural biology offer exciting opportunities to deepen our understanding of respiratory chain mechanisms:

• High-resolution structural determination:

  • Cryo-electron microscopy of the entire NDH-1 complex from Hydrogenobaculum sp.

  • X-ray crystallography of nuoK in complex with interacting subunits

  • Neutron diffraction to locate proton positions in key residues involved in proton translocation

• Dynamic structural studies:

  • Time-resolved structural methods to capture different conformational states during the catalytic cycle

  • Hydrogen/deuterium exchange mass spectrometry to identify dynamic regions and solvent-accessible proton pathways

  • Single-molecule FRET studies to detect conformational changes in real-time

• Integrative structural biology approaches:

  • Combination of cryo-EM, cross-linking mass spectrometry, and molecular dynamics simulations

  • Correlation of structural features with functional data from mutagenesis studies

  • Development of comprehensive models of the proton translocation mechanism

• Structural comparison across extremophiles:

  • Comparative analysis of nuoK structures from organisms adapted to different extreme environments

  • Identification of structural adaptations that confer thermostability or acid tolerance

  • Evolution of structural features in relation to environmental adaptations

• Protein engineering based on structural insights:

  • Rational design of nuoK variants with enhanced stability or altered proton-pumping properties

  • Creation of chimeric proteins incorporating beneficial features from different species

  • Development of minimalistic proton pumps based on essential structural elements of nuoK

The small size of nuoK (110 amino acids in Hydrogenobaculum sp. Y04AAS1) presents both challenges and opportunities for structural biology. While its hydrophobic nature complicates structural studies, its relatively simple architecture may provide fundamental insights into the minimal requirements for proton translocation in respiratory complexes.