Recombinant Hydropotes inermis NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Expression

Recombinant MT-ND4L is produced via heterologous expression systems, primarily in E. coli:

ParameterDetailSource
Expression HostE. coli (with N-terminal His6-ABP tag or other affinity tags)
Purification MethodIMAC chromatography (for His-tagged variants)
Yield/Purity>80% purity (SDS-PAGE confirmed); concentration >0.5 mg/mL
Storage BufferPBS with 1M urea (pH 7.4) or Tris-based buffer with 50% glycerol

Variants include full-length and truncated forms, with His-tagged versions optimized for antibody binding assays .

Functional Roles in Mitochondrial Biology

MT-ND4L is integral to Complex I’s catalytic cycle:

  1. Electron Transfer: Facilitates NADH → FMNH₂ → ubiquinone electron flow, coupled to proton pumping .

  2. Proton Translocation: Contributes to the transmembrane proton gradient driving ATP synthesis .

  3. Disease Association:

    • Leber’s Hereditary Optic Neuropathy (LHON): A T10663C mutation in human MT-ND4L (Val65Ala) disrupts Complex I function, leading to optic nerve degeneration .

    • Metabolic Disorders: Linked to obesity, diabetes, and hypertension in genetic studies .

Antibody Competition Assays

Recombinant MT-ND4L is used to validate antibody specificity:

ApplicationMethodSource
Antibody BlockingCompetes with anti-MT-ND4L antibodies (e.g., NBP2-53545)
ELISA AntigensCoated in microwell plates for detecting MT-ND4L-specific antibodies

Leber’s Hereditary Optic Neuropathy (LHON)

The T10663C mutation in MT-ND4L (human) impairs Complex I activity, reducing ATP production in retinal ganglion cells. While the mechanism remains unclear, mitochondrial dysfunction is central to optic nerve degeneration .

Mitochondrial Complex I Deficiency

Mutations in MT-ND4L or related genes (e.g., MT-ND1, MT-ND6) cause systemic deficiencies in oxidative phosphorylation, leading to multisystem disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Hydropotes inermis (Chinese water deer)
Target Names
Target Protein Sequence
MSLVYMNIMTAFTVSLVGLLMYRSHLMSSLLCLEGMMLSLFVMATLTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the MT-ND4L gene and what is its significance in Hydropotes inermis?

The MT-ND4L gene in Hydropotes inermis encodes the NADH-ubiquinone oxidoreductase chain 4L protein, a critical component of mitochondrial complex I in the electron transport chain. This protein participates in the first step of electron transport during oxidative phosphorylation, contributing to cellular energy production. In Hydropotes inermis (water deer), the MT-ND4L gene is part of the complete mitochondrial genome, which is 16,355 bp in length . The significance of studying this protein lies in understanding evolutionary relationships among cervids, mitochondrial energy metabolism mechanisms, and potential implications for mitochondrial disorders.

What is the genomic context of MT-ND4L in the Hydropotes inermis mitochondrial genome?

In the water deer mitochondrial genome, MT-ND4L is one of 13 protein-coding genes, alongside 22 tRNA genes, rRNA genes, and a control region . A notable feature is the overlap between the MT-ND4L gene and the ND4 gene, representing one of two gene overlaps observed in the mitochondrial genome of Hydropotes inermis . This overlapping genomic organization has significant implications for understanding gene expression regulation and mitochondrial genome evolution in cervids. The complete mitochondrial genome has a nucleotide composition of 30.52% A, 33.38% T, 22.77% G, and 13.32% C .

How does the MT-ND4L protein structure compare between Hydropotes inermis and other mammalian species?

While the specific structure of Hydropotes inermis MT-ND4L has not been fully characterized in the available literature, comparisons can be made with other mammalian MT-ND4L proteins. Typically, MT-ND4L proteins are approximately 11 kDa in size and consist of about 98 amino acids . They form part of the core transmembrane region of complex I and are characterized by high hydrophobicity . The protein structure is likely conserved across mammals due to functional constraints, with an L-shaped configuration including hydrophobic transmembrane domains embedded in the inner mitochondrial membrane .

CharacteristicTypical Mammalian MT-ND4LNotes for Hydropotes inermis MT-ND4L
Protein Size~11 kDaExpected to be similar based on conservation
Amino Acid Count~98 amino acidsExpected to be similar to other cervids
LocationInner mitochondrial membranePart of Complex I transmembrane domain
Structural FeatureHighly hydrophobicForms core of transmembrane region
Gene OverlapOverlaps with MT-ND4Confirmed in Hydropotes inermis mitochondrial genome

What is the role of MT-ND4L in cellular energy production?

MT-ND4L functions as an integral subunit of complex I (NADH dehydrogenase) in the mitochondrial electron transport chain. This complex is responsible for the first step in the electron transport process, transferring electrons from NADH to ubiquinone . During this process, protons are pumped from the mitochondrial matrix to the intermembrane space, creating an electrochemical gradient that drives ATP synthesis . MT-ND4L, as part of the membrane domain of complex I, contributes to the structural integrity of the complex and likely participates in forming the proton translocation pathway, though its exact mechanistic role remains an active area of research.

What are the recommended protocols for isolating the MT-ND4L gene from Hydropotes inermis tissue samples?

For isolating the MT-ND4L gene from Hydropotes inermis tissue samples, a systematic approach is recommended:

  • Tissue Selection and Preservation: Fresh muscle or liver tissue is preferred, preserved immediately in RNAlater or by flash-freezing in liquid nitrogen.

  • Total DNA Extraction: Use a commercial kit optimized for mitochondrial DNA extraction. Standard phenol-chloroform methods may also be effective.

  • PCR Amplification Strategy: Design primers based on conserved regions flanking the MT-ND4L gene in related cervid species. Consider the following:

    • Account for the overlap with the ND4 gene

    • Include at least 50-100 bp of flanking sequence

    • Optimize annealing temperature (typically 55-60°C)

  • Sequencing Verification: Confirm the amplified product through bidirectional Sanger sequencing.

  • Cloning Preparation: Add appropriate restriction sites to primers for subsequent cloning into expression vectors.

This approach has been successfully used for mitochondrial gene isolation in related species and can be adapted for Hydropotes inermis.

What expression systems are most effective for producing recombinant MT-ND4L protein?

The selection of an appropriate expression system is critical for successful production of recombinant MT-ND4L protein:

Expression SystemAdvantagesDisadvantagesRecommendation for MT-ND4L
Escherichia coliHigh yield, cost-effective, simpleMay improperly fold membrane proteins, lacks post-translational modificationsSuitable with specialized vectors and fusion tags
Saccharomyces cerevisiaeEukaryotic system, better for membrane proteinsLower yield than E. coliGood alternative if E. coli expression fails
Insect cell systemExcellent for complex mammalian proteinsExpensive, technically demandingConsider for functional studies requiring native conformation
Cell-free systemsAvoids toxicity issues, rapidExpensive, limited scaleUseful for initial expression trials

For recombinant MT-ND4L expression, E. coli systems using vectors designed for membrane proteins (such as pET series) with appropriate fusion tags (such as His-tag) are commonly employed, similar to the approach used for Canis lupus MT-ND4L . Codon optimization for the expression host is essential to improve expression efficiency.

What purification strategies are most effective for recombinant MT-ND4L protein?

Purification of recombinant MT-ND4L presents challenges due to its hydrophobic nature. A multi-step strategy is recommended:

  • Membrane Fraction Isolation: After cell lysis, separate membrane fractions by ultracentrifugation.

  • Detergent Solubilization: Use mild detergents such as n-dodecyl β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to extract the protein while maintaining native structure.

  • Affinity Chromatography: For His-tagged constructs, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin .

  • Size Exclusion Chromatography: Remove aggregates and further purify the protein.

  • Buffer Optimization: Maintain protein stability with appropriate buffers containing stabilizing agents (5-10% glycerol is recommended) .

  • Quality Assessment: Verify purity using SDS-PAGE (>90% purity is desirable) and Western blotting.

For long-term storage, lyophilization with protective agents such as trehalose (6%) has proven effective for similar proteins .

What techniques are most appropriate for determining the structure of recombinant Hydropotes inermis MT-ND4L?

Determining the structure of recombinant MT-ND4L requires specialized approaches due to its membrane protein nature:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets) and can be used to confirm proper folding.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: While challenging for membrane proteins, recent advances in detergent micelles and nanodiscs have made it more feasible for smaller membrane proteins like MT-ND4L.

  • Cryo-Electron Microscopy (Cryo-EM): Currently the most promising approach for complex I components, allowing visualization of the protein in near-native states at increasingly high resolutions.

  • X-ray Crystallography: Challenging for membrane proteins but possible with appropriate crystallization conditions.

  • Computational Modeling: Homology modeling based on known structures of MT-ND4L from other species can provide preliminary structural insights when experimental data is limited.

Each method provides complementary information, and a combination of approaches is often necessary for comprehensive structural characterization.

How can researchers assess the functional integrity of purified recombinant MT-ND4L?

Assessing functional integrity of recombinant MT-ND4L requires both direct and indirect approaches:

  • Complex I Activity Assays: Reconstitute the purified MT-ND4L with other complex I components and measure NADH:ubiquinone oxidoreductase activity using spectrophotometric methods.

  • Membrane Integration Assays: Verify proper insertion into lipid bilayers using fluorescence-based assays or proteoliposome reconstitution.

  • Protein-Protein Interaction Studies: Assess interactions with other complex I subunits using techniques such as co-immunoprecipitation, cross-linking, or microscale thermophoresis.

  • Thermal Stability Assays: Differential scanning fluorimetry to evaluate protein stability under various conditions.

  • Complementation Studies: Express the recombinant protein in cell lines with MT-ND4L deficiency to assess functional rescue capabilities.

These complementary approaches can provide a comprehensive evaluation of whether the recombinant protein retains its native functional characteristics.

What methods can be used to study the electron transport function of MT-ND4L within complex I?

Studying the electron transport function of MT-ND4L within complex I requires sophisticated biophysical and biochemical techniques:

  • Oxygen Consumption Measurements: Using oxygen electrodes (Clark-type) to measure respiration rates in reconstituted systems or mitochondrial preparations.

  • Spectrophotometric Assays: Monitoring NADH oxidation (decrease in absorbance at 340 nm) coupled to artificial electron acceptors.

  • Membrane Potential Measurements: Using potential-sensitive fluorescent dyes to monitor proton pumping activity.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: For detecting and characterizing electron transfer components and reactive intermediates.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues in MT-ND4L to identify functionally important amino acids.

  • Supercomplex Analysis: Investigating how MT-ND4L contributes to the formation and stability of respiratory supercomplexes using blue native PAGE and activity staining.

These methods collectively provide insights into how MT-ND4L contributes to electron transport and energy conversion in the mitochondrial respiratory chain.

How does MT-ND4L from Hydropotes inermis compare with that of other cervid species?

Comparative analysis of MT-ND4L across cervid species provides evolutionary insights:

SpeciesMT-ND4L Size (amino acids)Sequence Identity with H. inermisNotable Features
Hydropotes inermis~98 (predicted)100%Overlaps with ND4 gene
Other Cervidae~98 (typical)90-98% (estimated)High conservation in transmembrane regions
Canis lupus (as reference)98 80-85% (estimated)NADH dehydrogenase function conserved

While specific sequence comparison data for Hydropotes inermis MT-ND4L with other cervids is not provided in the search results, general patterns in mitochondrial proteins suggest high conservation among closely related species. Sequence variations typically occur in non-functional regions while maintaining conserved functional domains essential for complex I assembly and activity.

What insights can be gained from studying mutations in MT-ND4L across species?

Studying MT-ND4L mutations across species provides valuable insights into protein function and disease mechanisms:

  • Functional Constraints: Highly conserved residues across species likely represent functionally critical sites for complex I activity or assembly.

  • Disease Associations: In humans, mutations in MT-ND4L have been associated with Leber's Hereditary Optic Neuropathy (LHON) . Comparative analysis can reveal whether similar mutation sites exist in Hydropotes inermis and other mammals.

  • Adaptive Evolution: Sites under positive selection may indicate adaptation to different metabolic demands or environmental conditions.

  • Structural Insights: Mapping conserved and variable regions onto structural models can identify functional domains and interaction surfaces.

  • Phylogenetic Relationships: MT-ND4L sequence variations can contribute to resolving evolutionary relationships among cervids and other mammals.

This comparative approach connects molecular variation with functional consequences and evolutionary history.

How can recombinant Hydropotes inermis MT-ND4L be used as a model for studying mitochondrial diseases?

Recombinant Hydropotes inermis MT-ND4L offers several advantages as a model for studying mitochondrial diseases:

  • Disease Mutation Modeling: Introducing mutations corresponding to human mitochondrial disease variants (such as those causing LHON) into the recombinant protein allows biochemical characterization of pathogenic mechanisms.

  • Comparative Functional Studies: Comparing wild-type and mutant proteins can reveal how specific amino acid changes affect:

    • Protein stability and folding

    • Complex I assembly

    • Electron transport efficiency

    • Reactive oxygen species production

  • Drug Screening Platform: Reconstituted systems containing recombinant MT-ND4L can be used to screen potential therapeutic compounds targeting mitochondrial complex I dysfunction.

  • Evolutionary Medicine Insights: Comparing disease-associated mutations across species can identify compensatory mechanisms that might inform therapeutic strategies.

This approach bridges basic research and clinical applications, potentially contributing to our understanding of mitochondrial disease mechanisms.

What are the challenges and solutions for reconstituting functional MT-ND4L within a complete complex I structure?

Reconstituting functional MT-ND4L within complete complex I presents several challenges:

ChallengeDescriptionPotential Solutions
Multi-subunit AssemblyComplex I consists of 45 subunits in mammalsStepwise assembly approach starting with core subunits
Membrane Protein StabilityHydrophobic subunits like MT-ND4L are difficult to maintain in stable formUse of mild detergents or nanodiscs/lipid bilayer systems
Cofactor IncorporationEnsuring proper integration of Fe-S clusters and other cofactorsCo-expression with assembly factors; careful redox control
Functional AssessmentVerifying that the reconstituted complex is functionally activeMultiple complementary activity assays
Structural VerificationConfirming proper assembly and structureCryo-EM analysis of reconstituted complexes

Recent advances in membrane protein biochemistry, including the development of styrene-maleic acid lipid particles (SMALPs) and nanodiscs, provide promising approaches for overcoming these challenges and achieving functional reconstitution.

How can molecular dynamics simulations enhance our understanding of MT-ND4L function?

Molecular dynamics (MD) simulations offer powerful approaches for investigating MT-ND4L function at the atomic level:

  • Conformational Dynamics: Simulations can reveal how MT-ND4L changes conformation during the catalytic cycle of complex I, potentially identifying mechanistically important movements.

  • Proton Translocation Pathways: MD can visualize potential proton channels and calculate energy barriers for proton movement through the protein.

  • Lipid-Protein Interactions: Simulations can identify how specific lipids interact with MT-ND4L and influence its structure and function.

  • Mutation Effects: In silico mutagenesis can predict how disease-associated mutations might alter protein structure, stability, and function.

  • Interaction Networks: Mapping networks of interactions between MT-ND4L and other complex I subunits can identify critical interfaces for complex assembly and function.

These computational approaches complement experimental methods and provide mechanistic insights difficult to obtain through other techniques.

What are common challenges in expressing recombinant MT-ND4L and how can they be addressed?

Expression of recombinant MT-ND4L faces several challenges due to its hydrophobic nature:

  • Low Expression Yields:

    • Solution: Optimize codon usage for expression host; reduce induction temperature (16-20°C); use specialized promoters

    • Alternative: Test multiple expression systems (bacterial, yeast, insect cells)

  • Protein Toxicity to Host Cells:

    • Solution: Use tightly regulated expression systems; reduce expression time

    • Alternative: Consider cell-free expression systems

  • Protein Misfolding/Aggregation:

    • Solution: Co-express with molecular chaperones; use fusion partners that enhance solubility

    • Alternative: Direct expression into membrane fractions using signal sequences

  • Difficult Extraction from Membranes:

    • Solution: Screen multiple detergents for optimal solubilization

    • Alternative: Use styrene-maleic acid copolymers (SMAs) to extract in native membrane patches

  • Degradation During Expression:

    • Solution: Include protease inhibitors; reduce expression time; optimize growth medium

    • Alternative: Test protease-deficient host strains

Systematic optimization of these parameters has proven successful for other mitochondrial membrane proteins and can be applied to Hydropotes inermis MT-ND4L.

How can researchers validate that recombinant MT-ND4L maintains its native conformation?

Validating the native conformation of recombinant MT-ND4L requires multiple complementary approaches:

  • Structural Analysis:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Limited proteolysis patterns compared to native protein

    • Hydrodynamic radius measurement (size exclusion chromatography)

  • Functional Tests:

    • Ability to assemble with other complex I components

    • Reconstitution of electron transport activity

    • Binding to known interaction partners

  • Antibody Recognition:

    • Reactivity with conformation-specific antibodies

    • Epitope accessibility patterns similar to native protein

  • Thermal Stability:

    • Melting temperature comparable to native protein

    • Stabilization by same factors (cofactors, lipids)

  • Spectroscopic Properties:

    • Fluorescence emission spectra of intrinsic fluorophores

    • NMR fingerprinting of selected residues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.