Recombinant Hylobates klossii Taste receptor type 2 member 38 (TAS2R38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are made with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R38; Taste receptor type 2 member 38; T2R38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Hylobates klossii (Kloss's gibbon)
Target Names
Target Protein Sequence
MLTLTRICTVSYEVRSTFLFISVLEFAVGFLTNAFIFLVNFWDVVKRQPLSNSDCVLLCL SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYHAIIMLWMIANQANLWLATCLSLLYCSK LIRSSHTFLICLASWVSRKICQMLLGIILCSCICTVLCVWCYFSRPHFTVTTVLFTNNNT RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDFRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG NAKLRRAVTTILLWAQSSLKVRADHKADSRTLC
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is gustducin-linked. It may contribute to sensing the chemical composition of the gastrointestinal content. Activation of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of TAS2R38 and how does it compare between humans and Hylobates klossii?

TAS2R38 is a seven-transmembrane G protein-coupled receptor that belongs to the taste receptor family 2 (T2R). The protein has an N-terminal extracellular domain, a C-terminal cytoplasmic domain, and seven transmembrane α-helical domains. The third α-helix is highly conserved across species, reflecting its critical role in receptor stability and activation . In humans, the full-length protein consists of 333 amino acids . While specific structural data for Hylobates klossii TAS2R38 is limited, comparative analysis with human TAS2R38 would focus on the three key polymorphic sites (positions 49, 262, and 296) that determine taster status, as these are likely conserved to varying degrees across primate species.

What are the primary functions of TAS2R38 in different tissues?

  • Gustatory function: Detection of bitter compounds in food

  • Innate immunity: Defense against pathogens in respiratory epithelium

  • Gastrointestinal function: Sensing chemical composition of gut contents

The tissue-dependent expression patterns observed in studies suggest that TAS2R38 may have tissue-specific functions regulated by different mechanisms .

How do common TAS2R38 variants affect receptor function?

TAS2R38 exhibits two predominant common variants outside of Africa: the taster (PAV) and non-taster (AVI) variants . These variants differ at three nucleotide positions that result in amino acid changes:

PositionTaster variant (PAV)Non-taster variant (AVI)
49Proline (P)Alanine (A)
262Alanine (A)Valine (V)
296Valine (V)Isoleucine (I)

The taster variant (PAV) responds to bitter compounds like PTC and PROP, while the non-taster variant (AVI) shows little to no response to these compounds at low concentrations . Heterozygous individuals (PAV/AVI) display varying degrees of bitter taste perception despite having the same genotype, suggesting additional factors beyond genotype affect TAS2R38 function . These variations likely extend to non-gustatory functions as well, with studies showing the AVI variant is associated with increased risk of colorectal cancer and Pseudomonas aeruginosa-associated sinus infections .

What are the optimal expression systems for producing functional recombinant Hylobates klossii TAS2R38?

For recombinant expression of GPCRs like TAS2R38, several expression systems have proven effective, though each has advantages and limitations:

  • Mammalian cell lines (HEK293, CHO): These provide the most native-like post-translational modifications and membrane composition. For Hylobates klossii TAS2R38, these systems are likely to maintain proper folding and functional properties.

  • Insect cell systems (Sf9, High Five): The baculovirus expression system offers high protein yields while maintaining most post-translational modifications. This system represents a good compromise between yield and functionality.

  • Yeast expression systems (Pichia pastoris, Saccharomyces cerevisiae): These can be used for larger-scale production but may have limitations in post-translational modifications.

For functional studies of recombinant Hylobates klossii TAS2R38, mammalian cell lines would be recommended as the primary expression system, as they provide the cellular machinery necessary for proper receptor folding, trafficking, and coupling to G-proteins like gustducin that are essential for signal transduction .

How does tissue-dependent expression of TAS2R38 impact experimental design for recombinant studies?

Research has demonstrated that TAS2R38 expression varies significantly across tissues, with no correlation between expression levels in different tissues of the same individual . This tissue-dependent expression has important implications for recombinant studies:

  • Selection of reference tissues: When studying recombinant Hylobates klossii TAS2R38, researchers should consider which native tissue's function they aim to replicate (taste buds, sinonasal epithelium, gastrointestinal tissues, etc.).

  • Promoter selection: Expression constructs should include promoters that reflect the tissue-specific regulation observed in vivo.

  • Co-expression partners: Different tissues may have different signaling partners; taste tissues utilize alpha-gustducin, PLC-beta-2, and TRPM5 , while other tissues may employ different signaling pathways.

  • Expression quantification: Methods like quantitative PCR should be employed to measure mRNA expression levels in different experimental contexts, following protocols similar to those used in studies of human TAS2R38 expression .

The independence of expression levels between tissues suggests tissue-specific regulatory mechanisms that should be considered when designing heterologous expression systems for functional studies .

What are the challenges in assessing ligand binding and signal transduction for recombinant TAS2R38?

Studying ligand interactions with recombinant TAS2R38 presents several technical challenges:

  • Membrane protein instability: As a seven-transmembrane protein, TAS2R38 requires a lipid environment for stability, making traditional binding assays difficult.

  • Ligand diversity: TAS2R38 responds to structurally diverse bitter compounds, including glucosinolates, PTC, and PROP , requiring multiple assay conditions.

  • Signal transduction complexity: The receptor activates a cascade involving alpha-gustducin, PLC-beta-2, and ultimately TRPM5 channel gating . Recombinant systems must reconstitute this pathway.

  • Allelic variations: Different alleles (PAV vs. AVI) show distinct functional properties , necessitating parallel studies of different variants.

Methodological approaches to address these challenges include:

  • Calcium imaging assays to measure receptor activation

  • BRET/FRET-based assays for monitoring G-protein coupling

  • Electrophysiological recordings when co-expressed with TRPM5

  • Computational modeling of the binding pocket, informed by the known amino acid differences between variants

How can evolutionary conservation analysis inform recombinant TAS2R38 research?

Comparative analysis of TAS2R38 across primate species provides valuable insights for recombinant protein studies. While specific data on Hylobates klossii TAS2R38 is limited, researchers should consider:

  • Conservation of key residues: The three polymorphic positions (49, 262, 296) that determine taster status in humans should be examined in Hylobates klossii to predict functional properties.

  • Species-specific ligand preferences: Different primate species have evolved under different dietary pressures, potentially leading to different ligand specificities.

  • Regulatory element conservation: Promoter and enhancer regions may show different patterns of conservation compared to coding regions, impacting expression patterns.

  • Molecular evolution rates: Comparing synonymous vs. non-synonymous substitution rates between human and Hylobates klossii TAS2R38 can reveal selective pressures on receptor function.

This evolutionary approach can guide the design of chimeric receptors or targeted mutations to understand structure-function relationships in recombinant studies.

What purification strategies yield optimal results for recombinant TAS2R38?

Purifying functional membrane proteins like TAS2R38 requires specialized approaches:

  • Detergent screening: Systematic testing of detergents (DDM, LMNG, etc.) to identify those that maintain TAS2R38 stability during extraction from membranes.

  • Affinity tags: Addition of tags (His6, FLAG, etc.) at positions that don't interfere with function, typically at the N-terminus or in intracellular loops.

  • Stabilizing mutations: Introduction of mutations that enhance thermostability without affecting function.

  • Lipid reconstitution: After purification, reconstitution into nanodiscs or liposomes to restore a native-like lipid environment.

For functional studies of recombinant Hylobates klossii TAS2R38, maintaining the protein in a properly folded state throughout purification is critical. Validation of structural integrity through methods like circular dichroism spectroscopy is essential before conducting functional assays.

How can functional assays be optimized for comparing human and Hylobates klossii TAS2R38?

To properly compare the functional properties of human and Hylobates klossii TAS2R38:

  • Standardized expression systems: Both proteins should be expressed in the same cell background with identical promoters, tags, and expression conditions.

  • Dose-response measurements: Full dose-response curves for multiple ligands should be generated to determine EC50 values and efficacy.

  • Signaling partner co-expression: Co-expression with relevant G-proteins (gustducin) and downstream effectors ensures complete signaling capabilities.

  • Real-time measurement techniques: Calcium imaging, BRET/FRET assays, or electrophysiology provide temporal resolution of signaling events.

  • Multiple readout parameters: Measuring both G-protein coupling and downstream calcium signals provides a more complete picture of receptor function.

This comparative approach will reveal both quantitative differences (potency, efficacy) and qualitative differences (ligand selectivity, signaling bias) between the human and Hylobates klossii receptors.

What techniques are most effective for studying TAS2R38 expression patterns across tissues?

Based on established research methodologies, the following approaches are recommended for studying TAS2R38 expression:

  • Quantitative PCR: This technique has been successfully used to measure TAS2R38 mRNA expression in taste and sinonasal tissues . Key considerations include:

    • Selection of appropriate reference genes

    • RNA quality assessment (RIN values)

    • Primer design to distinguish between splice variants

  • In situ hybridization: For localizing TAS2R38 expression within tissue sections, providing cellular resolution.

  • Immunohistochemistry: Using validated antibodies to detect protein expression, though careful validation is essential due to potential cross-reactivity.

  • Single-cell RNA sequencing: For more detailed analysis of expression in heterogeneous tissues, revealing cell type-specific expression patterns.

Studies have shown that TAS2R38 mRNA expression varies independently across tissues, with expression in taste tissue not predicting expression in other tissues like sinonasal epithelium . This finding highlights the importance of multi-tissue analysis when characterizing expression patterns of recombinant TAS2R38.

How does TAS2R38 genotype influence disease susceptibility and what are the implications for comparative studies?

Research has revealed associations between TAS2R38 variants and multiple disease conditions:

  • Respiratory infections: The AVI variant is associated with increased susceptibility to Pseudomonas aeruginosa infections, particularly relevant in cystic fibrosis patients .

  • Colorectal cancer: Studies have linked the AVI variant to increased colorectal cancer risk .

  • Sinonasal immunity: TAS2R38 activation in sinonasal epithelial cells stimulates nitric oxide production and increases ciliary beating, enhancing pathogen clearance .

For comparative studies using recombinant Hylobates klossii TAS2R38, these findings suggest:

  • Investigation of whether similar genotype-phenotype correlations exist in non-human primates

  • Exploration of species-specific adaptations in immune function related to TAS2R38 variants

  • Development of model systems using recombinant proteins to study mechanism-based therapeutic approaches

What are the best experimental models for studying tissue-specific functions of recombinant TAS2R38?

Based on current knowledge of TAS2R38's diverse tissue expression , several experimental models are recommended:

  • Taste function: Heterologous expression in HEK293 cells coupled with calcium imaging provides a robust system for bitter taste response assessment .

  • Respiratory immunity: Primary human sinonasal epithelial cell cultures or air-liquid interface cultures can be transfected with recombinant constructs to study antimicrobial functions.

  • Intestinal function: Intestinal organoids derived from stem cells provide a physiologically relevant system for studying gastrointestinal roles.

  • Comparative studies: Parallel testing in multiple model systems is essential given the tissue-independence of TAS2R38 expression . For example, expression levels in taste tissue do not predict levels in sinonasal tissue within the same individual.

When using these models to study recombinant Hylobates klossii TAS2R38, researchers should consider the species-specific cellular environments that might affect receptor function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.