Recombinant Hylobates lar Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Hylobates lar (Common gibbon) (White-handed gibbon)
Target Names
Target Protein Sequence
MAHATQVGLQDATSPIMEELISFHDHALMIIFLISFLVLYALFLTLTTKLTNTNITDAQE METVWTILPAIILVLIALPSLRILYLTDEINDPSFTIKAIGHQWYWAYEYTDYGGLIFNS YMLPPLFLEPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTVPSLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprising heme A3 and CuB) in subunit 1. This binuclear center utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what function does it serve in Hylobates lar metabolism?

MT-CO2 (mitochondrial-encoded cytochrome c oxidase subunit 2) is an essential component of cytochrome c oxidase (CcO), which functions as the terminal enzyme in the mitochondrial electron transport chain. In Hylobates lar, as in other primates, MT-CO2 is integral to cellular respiration, facilitating the transfer of electrons to molecular oxygen to produce water while simultaneously contributing to the proton gradient necessary for ATP synthesis. This subunit contains the Cu A center, which serves as the primary electron acceptor from cytochrome c, making it critical for initial electron transfer in the oxidative phosphorylation process .

What are the recommended protocols for expressing recombinant Hylobates lar MT-CO2?

For optimal expression of recombinant Hylobates lar MT-CO2, a mammalian expression system is generally preferred due to the need for proper post-translational modifications and membrane insertion. The recommended protocol involves:

  • Gene synthesis based on the Hylobates lar MT-CO2 sequence with codon optimization for the expression system

  • Cloning into a vector containing a strong promoter (CMV) and appropriate selection marker

  • Transfection into HEK293 or CHO cells using lipofection or electroporation

  • Selection of stable transfectants using appropriate antibiotics

  • Verification of expression using Western blotting with anti-MT-CO2 antibodies

  • Purification via affinity chromatography using a C-terminal tag (His or FLAG)

For functional studies, co-expression with other cytochrome c oxidase subunits may be necessary to ensure proper complex assembly and activity .

What spectroscopic methods are most effective for analyzing the functional integrity of recombinant Hylobates lar MT-CO2?

The functional integrity of recombinant Hylobates lar MT-CO2 can be most effectively analyzed using multiple complementary spectroscopic approaches:

  • Absorption spectroscopy (550-650 nm range) to monitor redox state changes of the heme groups and copper centers

  • Resonance Raman spectroscopy to examine metal-ligand vibrations and confirm proper coordination environment of the Cu A center

  • Electron paramagnetic resonance (EPR) spectroscopy to verify the integrity of the Cu A center's electronic structure

The potassium cyanide differential spectroscopy method is particularly valuable as it allows selective monitoring of cytochrome c oxidase in the presence of other hemoproteins. This approach involves measuring absorbance differences at 605 nm before and after the addition of potassium cyanide, which selectively affects cytochrome c oxidase. For recombinant MT-CO2 specifically, comparing the spectral characteristics with those of the native enzyme provides validation of proper folding and metal center incorporation .

How can researchers effectively validate the authenticity of recombinant Hylobates lar MT-CO2?

Validating the authenticity of recombinant Hylobates lar MT-CO2 requires a multi-faceted approach:

  • Protein sequence verification through mass spectrometry analysis (LC-MS/MS) to confirm primary structure matches the expected Hylobates lar MT-CO2 sequence

  • Western blot analysis using antibodies specific to conserved epitopes in MT-CO2

  • Functional assays measuring electron transfer rates from cytochrome c

  • Circular dichroism spectroscopy to verify secondary structure elements

  • Metal content analysis via inductively coupled plasma mass spectrometry (ICP-MS) to confirm proper copper incorporation

  • Activity assays comparing oxygen consumption rates with native cytochrome c oxidase

Additionally, researchers should perform phylogenetic comparison of the recombinant protein's sequence with reference sequences from databases to confirm species specificity and rule out contamination with human or other primate sequences. This is particularly important when working with samples derived from gibbons due to their close genetic relationship with humans .

What are the optimal buffer conditions for maintaining stability of purified recombinant Hylobates lar MT-CO2?

The optimal buffer conditions for maintaining stability of purified recombinant Hylobates lar MT-CO2 are:

Buffer ComponentRecommended ConcentrationPurpose
Phosphate buffer50 mM, pH 7.2-7.4Maintains physiological pH
NaCl100-150 mMProvides ionic strength
Glycerol10-15%Prevents aggregation
Detergent (DDM or CHAPS)0.05-0.1%Maintains membrane protein solubility
EDTA0.1 mMChelates contaminating metals
DTT or β-mercaptoethanol1 mMPrevents oxidation of sulfhydryl groups
Protease inhibitor cocktailAs per manufacturerPrevents degradation

Storage conditions should include flash freezing in liquid nitrogen and storage at -80°C for long-term preservation. For short-term storage (1-2 weeks), 4°C is acceptable with the addition of 0.02% sodium azide to prevent microbial growth. Avoid repeated freeze-thaw cycles as they significantly reduce activity. For experimental use, maintaining the protein in a buffer containing physiologically relevant levels of potassium and magnesium ions enhances stability and functional activity .

How do post-translational modifications affect the function of Hylobates lar MT-CO2, and how can these be preserved in recombinant systems?

Post-translational modifications (PTMs) significantly impact Hylobates lar MT-CO2 function through several mechanisms:

  • Phosphorylation at specific serine and threonine residues modulates electron transfer efficiency and affects interaction with other subunits of the cytochrome c oxidase complex

  • N-terminal acetylation influences protein stability and membrane insertion

  • Metal incorporation (primarily copper) is essential for catalytic function

In recombinant expression systems, preserving these PTMs requires careful consideration of the expression host and conditions. Mammalian cell lines (particularly primate-derived cells) offer the most suitable environment for preserving the natural PTM profile. Specific approaches include:

  • Using phosphatase inhibitors during purification to maintain phosphorylation states

  • Supplementing growth media with copper to ensure proper metallation

  • Employing site-directed mutagenesis to create phosphomimetic variants (glutamate or aspartate substitutions) at key sites when studying phosphorylation effects

  • Co-expressing with relevant kinases known to modify MT-CO2

Mass spectrometry-based proteomics should be used to verify the PTM profile of the recombinant protein against reference data from native Hylobates lar samples. Comparative analysis with human MT-CO2 can also provide insights, as certain critical PTM sites are conserved across primates .

What experimental approaches can detect potential differences in electron transfer kinetics between recombinant Hylobates lar MT-CO2 and its human counterpart?

Detecting differences in electron transfer kinetics between recombinant Hylobates lar MT-CO2 and its human counterpart requires sophisticated biophysical techniques:

  • Stopped-flow spectroscopy coupled with rapid-scan UV-visible detection to measure the kinetics of electron transfer from cytochrome c to the Cu A center

  • Pulse radiolysis to generate reduced cytochrome c and monitor subsequent electron transfer events

  • Temperature-dependence studies to determine activation energies for electron transfer

  • Point-by-point analysis of electron transfer rates using site-directed variants with alterations at key residues that differ between species

  • Laser flash photolysis with time-resolved spectroscopy to examine electron transfer events on microsecond to millisecond timescales

The experimental design should include parallel analysis of both proteins under identical conditions, controlling for protein concentration, detergent environment, and lipid composition. Careful data analysis using non-linear regression models can quantify differences in rate constants, which can be correlated with structural differences between the two proteins. This approach allows for identification of species-specific adaptations that may reflect evolutionary divergence in metabolic requirements .

How can researchers effectively study the interaction between recombinant Hylobates lar MT-CO2 and other subunits of the cytochrome c oxidase complex?

Studying interactions between recombinant Hylobates lar MT-CO2 and other cytochrome c oxidase subunits requires integrative approaches:

  • Co-immunoprecipitation experiments using tagged versions of MT-CO2 and other subunits

  • Blue native PAGE to analyze complex formation and stability

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters

  • Crosslinking mass spectrometry (XL-MS) to identify specific interaction sites

  • Fluorescence resonance energy transfer (FRET) assays using fluorescently labeled subunits to monitor interactions in real-time

  • Cryo-electron microscopy of reconstituted complexes to visualize structural arrangements

For hybrid complexes containing subunits from different species, researchers should systematically replace individual components to identify compatibility issues and functional consequences. This approach can reveal evolutionary constraints on protein-protein interactions within the respiratory chain. Additionally, mutagenesis of residues at interface regions can provide insights into the structural determinants of assembly and stability .

What evolutionary insights can be gained from studying sequence variations between Hylobates lar MT-CO2 and other primate species?

Studying sequence variations in MT-CO2 between Hylobates lar and other primates offers significant evolutionary insights:

  • Identification of positively selected sites that may reflect adaptation to specific metabolic demands

  • Analysis of evolutionary rates in different lineages to understand the selective pressures on mitochondrial function

  • Correlation of amino acid substitutions with ecological or physiological traits specific to gibbons

  • Examination of coevolution patterns between mitochondrial and nuclear-encoded subunits

Particularly valuable are comparisons between Hylobates lar and other gibbon species, as well as comparisons with great apes. The MT-CO2 gene has been used extensively in phylogenetic studies due to its relatively high mutation rate. Sequence analysis should focus on functional domains, especially residues involved in proton translocation pathways and interactions with other subunits. Adaptive evolution in MT-CO2 may reflect changes in energy demands related to the specialized brachiation locomotion of gibbons, which requires high metabolic output from skeletal muscles .

How do Hylobates lar MT-CO2 genetic variants correlate with population distribution and hybridization patterns?

The correlation between Hylobates lar MT-CO2 genetic variants and population distribution reveals complex evolutionary patterns:

  • Distinct MT-CO2 haplotypes cluster according to geographical distribution, reflecting historical population separation

  • Hybridization zones (e.g., between Hylobates lar and Hylobates pileatus) show evidence of mitochondrial introgression

  • Analysis of MT-CO2 variants can help delineate subspecies boundaries and track historical migration patterns

In hybridization zones, MT-CO2 sequences may not align with nuclear genetic patterns due to sex-biased gene flow, as mitochondrial DNA is maternally inherited. This can provide insights into the direction and extent of hybridization. Population genetic studies should include analysis of synonymous versus non-synonymous substitutions to detect signatures of selection. Additionally, researchers should examine whether certain MT-CO2 variants correlate with phenotypic traits or environmental factors across the species' range .

What are the most reliable assays for measuring enzymatic activity of recombinant Hylobates lar MT-CO2 within the cytochrome c oxidase complex?

The most reliable assays for measuring enzymatic activity of recombinant Hylobates lar MT-CO2 within the cytochrome c oxidase complex include:

  • Oxygen consumption assays using Clark-type oxygen electrodes or optical oxygen sensors

  • Spectrophotometric assays monitoring the oxidation of reduced cytochrome c at 550 nm

  • Proton pumping assays using pH-sensitive fluorescent dyes in reconstituted proteoliposomes

  • Membrane potential measurements using potential-sensitive fluorescent probes

For accurate results, experimental conditions should mimic physiological environments:

ParameterOptimal ConditionRationale
pH7.2-7.4Matches physiological pH in mitochondria
Temperature37°COptimal for primate protein function
Ionic strength100-150 mM KClMimics matrix conditions
Substrate concentration20-50 μM reduced cytochrome cEnsures saturation without inhibition

Control experiments should include inhibition studies using specific cytochrome c oxidase inhibitors (e.g., cyanide, azide) to confirm specificity. Comparison with native enzyme preparations serves as a benchmark for recombinant protein functionality .

How can researchers effectively study the role of MT-CO2 in oxidative stress responses using the recombinant Hylobates lar protein?

To study the role of MT-CO2 in oxidative stress responses using recombinant Hylobates lar protein, researchers should employ a multidisciplinary approach:

  • Site-directed mutagenesis of redox-sensitive residues followed by activity measurements under varying oxidative conditions

  • Detection of reactive oxygen species (ROS) production using fluorescent probes in reconstituted systems

  • Analysis of protein oxidative modifications (carbonylation, nitration) using mass spectrometry

  • Correlation of electron leak rates with structural features specific to Hylobates lar MT-CO2

  • Comparative studies with human MT-CO2 under identical oxidative stress conditions

Ex vivo systems can be particularly informative, such as incorporating the recombinant protein into cell lines with depleted endogenous cytochrome c oxidase and exposing them to oxidative stressors. Researchers should also examine how post-translational modifications change under oxidative stress and how these affect enzyme function. Understanding species-specific differences in oxidative stress responses could provide insights into metabolic adaptations and mitochondrial disease mechanisms .

What are the common challenges in expressing functional recombinant Hylobates lar MT-CO2, and how can they be addressed?

Common challenges in expressing functional recombinant Hylobates lar MT-CO2 include:

  • Poor membrane insertion

    • Solution: Optimize signal sequences or utilize cell-free systems with artificial membranes

    • Alternative: Express as a fusion protein with a membrane-targeting domain

  • Improper copper incorporation

    • Solution: Supplement growth media with copper and utilize chaperones

    • Alternative: Attempt post-purification metal reconstitution

  • Misfolding and aggregation

    • Solution: Express at lower temperatures (16-18°C) and use fusion partners that enhance solubility

    • Alternative: Employ chemical chaperones such as glycerol or trimethylamine N-oxide

  • Low expression levels

    • Solution: Optimize codon usage for the expression host and use stronger promoters

    • Alternative: Explore different expression hosts including insect cell systems

  • Proteolytic degradation

    • Solution: Include protease inhibitors throughout purification and use protease-deficient host strains

    • Alternative: Design constructs with stabilizing mutations based on comparative sequence analysis

Each challenge requires systematic optimization, with careful documentation of conditions that preserve both structure and function. Researchers should verify protein quality using size exclusion chromatography and dynamic light scattering to ensure homogeneity before functional studies .

How should researchers address discrepancies between in vitro activity of recombinant MT-CO2 and expected physiological function?

When addressing discrepancies between in vitro activity of recombinant MT-CO2 and expected physiological function, researchers should:

  • Evaluate the lipid environment

    • Native mitochondrial membranes contain specific phospholipids that may be essential for proper function

    • Reconstitution experiments should test different lipid compositions, particularly cardiolipin content

  • Consider the absence of interacting proteins

    • The isolated subunit or even the complete cytochrome c oxidase complex may lack regulatory proteins

    • Add potential physiological regulators (e.g., ATP, ADP) to in vitro assays

  • Examine post-translational modifications

    • Verify that the recombinant protein has the same modification pattern as the native protein

    • Use mass spectrometry to identify missing or altered modifications

  • Assess the impact of detergents

    • Detergents necessary for purification may alter protein conformation or activity

    • Test multiple detergents or detergent-free systems using nanodiscs or amphipols

  • Consider the redox environment

    • The cellular redox state may not be accurately reproduced in vitro

    • Adjust glutathione ratios or include physiological redox partners

Systematic investigation of these factors can help identify the source of discrepancies and improve the physiological relevance of in vitro studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.