Recombinant Hylobates lar Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Protein Overview

The Recombinant Hylobates lar MC1R is a G protein-coupled receptor (GPCR) with seven transmembrane domains, characteristic of the melanocortin receptor family . It is synthesized in vitro using cell-free expression systems to ensure high purity and functionality .

PropertyDetail
Host SystemCell-free expression
Purity≥85% (verified by SDS-PAGE)
Species OriginHylobates lar (Lar gibbon)
FunctionBinds α-MSH to activate cAMP signaling, influencing melanin synthesis .

Production and Purification

The recombinant protein is produced using advanced biotechnological methods:

  • Expression: Cell-free systems optimize yield and minimize misfolding .

  • Tagging: A His-tag facilitates purification via affinity chromatography .

  • Storage: Lyophilized in Tris/PBS buffer with trehalose to enhance stability .

ParameterSpecification
Expression VectorCustomized for high-fidelity translation
ReconstitutionDissolved in sterile water with glycerol (5–50%) for long-term storage
ApplicationsLigand binding studies, cAMP assays, melanogenesis research

Research Applications

This recombinant protein is pivotal in studying:

  • Pigmentation Mechanisms: How MC1R mutations affect eumelanin vs. pheomelanin ratios .

  • Cancer Biology: MC1R's role in melanoma progression and UV-induced DNA repair .

  • Evolutionary Studies: Species-specific MC1R variants and their functional divergence .

For instance, studies on primate MC1R variants (e.g., Macaca species) reveal that single amino acid substitutions (e.g., Y267C) can rescue α-MSH binding affinity and cAMP production, highlighting structural plasticity .

Comparative Insights

While direct data on Hylobates lar MC1R is limited, insights from related species inform its functional profile:

SpeciesKey MC1R FeatureReference
Homo sapiensLoss-of-function mutations linked to red hair
Macaca nemestrinaHigh basal cAMP signaling due to constitutive activity
Trachypithecus cristatusRecombinant MC1R expressed in E. coli with His-tag

Future Directions

Current research gaps include:

  • Structural Resolution: Cryo-EM or X-ray crystallography to map ligand-binding pockets.

  • In Vivo Studies: Testing recombinant MC1R in melanocyte models to assess repair pathways.

  • Therapeutic Potential: Targeting MC1R for melanoma treatment or photoprotection .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please communicate with us beforehand. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We select the tag type during production. If you have specific tag requirements, please let us know, and we will prioritize the development of your specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Hylobates lar (Common gibbon) (White-handed gibbon)
Target Names
Target Protein Sequence
MAVQGFQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV ATIAKNRNLHSPTYCFICCLALSDLLVSGGNVLETVVILLLEASALAARAAVVQPLDNVI DVITCSSMVSSLCFLGAIAMDRYVSIFYALRYHSIVTLPRARQAIAAIWVASVLFSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPLHQGFGLKGA VTLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RRQELRRTLKEGLTCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for α, β, and γ MSH and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. MC1R plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Melanocyte-stimulating hormone receptor (MC1R) and what is its primary function?

MC1R is a seven-pass transmembrane G protein-coupled receptor that functions as the receptor for melanocyte-stimulating hormone (MSH) . Its primary function is controlling melanogenesis, the process of melanin production in melanocytes. MC1R is expressed in melanocytes and plays a crucial role in determining the type of melanin produced - either red pheomelanin or black eumelanin . When activated by binding to α-MSH (alpha melanocyte-stimulating hormone), MC1R stimulates the cAMP signaling pathway, which leads to increased production of photoprotective eumelanin . Beyond pigmentation, MC1R has been demonstrated to participate in DNA repair pathways following ultraviolet radiation exposure, making it an important factor in photoprotection and cancer prevention .

For research purposes, investigating MC1R function typically requires receptor binding assays with labeled ligands, cAMP accumulation assays to measure pathway activation, and cellular models expressing either wild-type or variant MC1R. When studying the Hylobates lar MC1R specifically, researchers should consider evolutionary aspects of receptor conservation and compare findings with human MC1R data to identify functional similarities and differences that may relate to species-specific adaptations to UV exposure.

How does the structure of Hylobates lar MC1R compare to human MC1R?

The Hylobates lar (common gibbon) MC1R shares significant structural homology with human MC1R, reflecting evolutionary conservation of this receptor across primates. The recombinant Hylobates lar MC1R protein consists of 317 amino acids, forming the characteristic seven transmembrane domain structure typical of G protein-coupled receptors . The amino acid sequence of Hylobates lar MC1R reveals conserved motifs necessary for ligand binding and signal transduction, particularly in the transmembrane domains that form the ligand-binding pocket and intracellular regions responsible for G-protein coupling.

Methodologically, comparing these receptors requires sequence alignment analysis to identify conserved and divergent residues between human and gibbon MC1R. Critical functional regions to examine include the extracellular N-terminal domain involved in ligand recognition and the intracellular regions responsible for downstream signaling activation. Hylobates lar MC1R contains the key structural elements necessary for melanocortin binding and signaling, including the DRY motif in the second intracellular loop that is important for G-protein coupling and the conserved cysteine residues that may undergo palmitoylation - a post-translational modification essential for receptor function .

By studying the recombinant Hylobates lar MC1R, researchers can gain insights into the evolutionary conservation of structure-function relationships in this receptor family and potentially identify species-specific adaptations related to different environmental UV exposures experienced by humans and gibbons in their respective habitats.

What signaling pathways does MC1R activate?

MC1R primarily activates the cAMP signaling pathway upon binding its agonist α-MSH . When activated, MC1R couples to Gs proteins, stimulating adenylyl cyclase to convert ATP to cAMP, which subsequently activates protein kinase A (PKA). Activated PKA phosphorylates the cAMP response element-binding protein (CREB), which then induces the expression of microphthalmia-associated transcription factor (MITF), a master regulator of melanocyte development and melanogenesis .

Beyond the canonical cAMP pathway, MC1R signaling also interfaces with other cellular pathways. Research has shown that MC1R activation can influence mitogen-activated protein kinase (MAPK) pathways and calcium signaling . Additionally, MC1R plays a crucial role in activating DNA damage response pathways following ultraviolet radiation exposure, including nucleotide excision repair mechanisms that protect genomic integrity .

To study these pathways methodologically, researchers typically employ a combination of techniques. These include measuring second messenger (cAMP) accumulation using ELISA or BRET-based assays, assessing protein phosphorylation with phospho-specific antibodies, employing reporter gene constructs to measure transcriptional outcomes, and using pharmacological inhibitors to delineate pathway connections. The complete pathway analysis should include measurement of both immediate signaling events (cAMP production, CREB phosphorylation) and downstream functional outcomes such as melanin synthesis and DNA repair capacity.

What is the role of MC1R in melanogenesis?

MC1R plays a central role in melanogenesis by regulating the type of melanin produced in melanocytes . Upon binding melanocortins like α-MSH, MC1R activates the cAMP pathway, leading to increased expression of enzymes involved in eumelanin synthesis, particularly tyrosinase, tyrosinase-related protein 1 (TYRP1), and dopachrome tautomerase (DCT) . Eumelanin is a dark, photoprotective pigment that shields the skin from UV radiation damage by absorbing and dissipating UV energy.

In contrast, when MC1R signaling is low or absent (as occurs with certain MC1R variants or in the presence of the inverse agonist ASIP), melanocytes produce pheomelanin instead . Pheomelanin is a reddish-yellow pigment that provides less photoprotection and may even contribute to UV-induced damage by generating free radicals upon UV radiation exposure . This balance between eumelanin and pheomelanin production is critical for understanding pigmentation phenotypes and UV sensitivity.

Research on MC1R's role in melanogenesis employs multiple methodological approaches. Melanin content can be quantified spectrophotometrically after alkaline dissolution of isolated melanin granules. The expression and activity of melanogenic enzymes can be assessed by qRT-PCR, Western blotting, and enzyme activity assays. Studies with recombinant Hylobates lar MC1R can provide comparative insights into how this receptor regulates melanogenesis across different primate species, potentially revealing evolutionary adaptations to different UV environments.

Why is recombinant MC1R used in research?

Recombinant MC1R proteins, such as the Hylobates lar MC1R, serve as valuable research tools for several important reasons. First, they provide purified receptor proteins for in vitro binding studies, structural analyses, and antibody generation . These purified proteins enable researchers to study receptor-ligand interactions in controlled conditions without the confounding variables present in complex cellular systems.

Second, recombinant MC1R allows for comparative studies across species to understand evolutionary conservation and divergence of receptor function . By examining MC1R from different primates like Hylobates lar, researchers can identify adaptive changes that might correlate with environmental pressures such as varying UV exposure levels in different habitats. This comparative approach can reveal which receptor domains are most conserved (likely essential for function) and which show species-specific variations that might reflect adaptation.

Third, recombinant MC1R serves as an essential component in developing quantitative assays for receptor function and as immunogens for antibody production . The availability of high-quality recombinant protein with defined properties (amino acids 1-317 of the full-length protein) ensures experimental reproducibility and reliable antibody generation . For optimal use in research applications, the recombinant Hylobates lar MC1R should be stored at -20°C for general storage or -80°C for extended preservation, with working aliquots maintained at 4°C for up to one week to minimize freeze-thaw cycles that can degrade protein integrity .

How does MC1R contribute to chromosome stability and centromeric integrity after UV irradiation?

MC1R plays a crucial role in maintaining chromosome stability and centromeric integrity following UV radiation exposure . Research has demonstrated that α-MSH/MC1R signaling protects melanocytes from accumulating UV-induced chromosomal aberrations, particularly centromeric fragmentations . When MC1R is silenced or its signaling is compromised, human primary melanocytes exhibit increased cytogenetic alterations after UVB exposure, including significant centromeric fragmentation .

The protective mechanism involves MC1R's influence on centromere structure and function. Studies have shown that MC1R affects the binding of centromeric proteins CENP-A and CENP-C to satellite DNA sequences (Sata and Sat2) . When MC1R is depleted, this binding is disrupted, potentially leading to centromere dysfunction and increased genomic instability . Additionally, cells with MC1R depletion show increased frequency of lagging chromosomes and anaphase bridges during cell division after UV exposure, further indicating centromere instability .

Methodologically, researchers investigating this phenomenon should employ chromosome spread techniques with Giemsa staining to visualize gross chromosomal abnormalities. Fluorescence in situ hybridization (FISH) with centromere-specific probes can specifically identify centromeric fragmentations . Chromatin immunoprecipitation (ChIP) assays can assess the binding of centromeric proteins to their target DNA sequences under different conditions. This research direction represents an important frontier in understanding MC1R's protective functions beyond its established role in pigmentation.

What experimental approaches can be used to study the palmitoylation-dependent functions of MC1R?

MC1R protein palmitoylation has been identified as essential for activating MC1R signaling and its protective functions against UV-induced damage . To study palmitoylation-dependent functions of MC1R, several experimental approaches can be employed effectively.

Chemical inhibition using palmitoylation inhibitors like 2-bromopalmitic acid (2-BrP) represents a straightforward approach. Treatment of melanocytes with 2-BrP (50 μM) before UV exposure allows researchers to assess how palmitoylation inhibition affects MC1R's protective functions . Studies have shown that 2-BrP treatment abrogates the protective effect of α-MSH/MC1R on chromosome stability after UVB irradiation, suggesting that palmitoylation is essential for this function .

Site-directed mutagenesis of putative palmitoylation sites (cysteine residues) in MC1R can create non-palmitoylatable mutants. Comparing the function of these mutants with wild-type MC1R provides insights into which specific functions depend on palmitoylation. For detection and quantification of protein palmitoylation, biochemical techniques like acyl-biotin exchange (ABE) or click chemistry approaches can be employed. These methods allow for the selective labeling and isolation of palmitoylated proteins for further analysis.

Functional assessments should combine these techniques with assays measuring MC1R signaling (cAMP production), melanin synthesis, DNA repair capacity, and chromosome stability after UV exposure . This multi-faceted approach can delineate which aspects of MC1R function depend on palmitoylation and potentially identify therapeutic strategies to enhance MC1R function through modulation of this post-translational modification.

How can researchers differentiate between constitutive and ligand-induced MC1R signaling?

Differentiating between constitutive (basal) and ligand-induced MC1R signaling is critical for understanding receptor function, particularly since MC1R has been reported to exhibit constitutive activity . Several methodological approaches can help researchers make this important distinction.

Pharmacological approaches using competitive antagonists versus inverse agonists provide valuable insights. Competitive antagonists block ligand-induced signaling but don't affect constitutive activity, while inverse agonists reduce constitutive signaling. Agouti signaling protein (ASIP) acts as an inverse agonist for MC1R . By comparing the effects of competitive antagonists and inverse agonists, researchers can distinguish between these two signaling modes.

Genetic approaches using POMC knockout models (lacking the precursor for α-MSH) have shown significant eumelanin pigmentation despite the absence of the endogenous ligand, suggesting substantial constitutive MC1R signaling . Similar approaches using CRISPR-Cas9 to generate POMC-knockout melanocyte lines can help assess constitutive MC1R activity in human cells.

Quantitatively, researchers should measure cAMP levels and downstream pathway activation (e.g., CREB phosphorylation, MITF expression) under basal conditions and after ligand stimulation. The ratio between these measurements provides an index of constitutive versus ligand-induced activity. Real-time signaling assays using BRET or FRET biosensors for cAMP or G-protein coupling can monitor MC1R activity continuously, establishing baseline constitutive activity and subsequent ligand-induced increases with high temporal resolution.

What methods are most effective for analyzing MC1R variant functionality in relation to DNA damage responses?

Analyzing MC1R variant functionality in relation to DNA damage responses requires a comprehensive approach combining molecular, cellular, and genetic techniques. Creating isogenic cell models using CRISPR-Cas9 technology generates melanocyte lines differing only in their MC1R variant status, eliminating confounding genetic variables . These models provide the cleanest system for comparing variant effects on DNA damage responses.

DNA repair pathway analysis should include nucleotide excision repair (NER) capacity measurement using host-cell reactivation assays, assessment of expression and activation of DNA repair proteins by qRT-PCR and Western blotting, and chromatin immunoprecipitation to determine recruitment of repair factors to damage sites. Cell fate outcomes should be evaluated through apoptosis assays, cell cycle analysis, and clonogenic survival assays for long-term effects.

For comparative analysis of multiple MC1R variants, researchers should employ a tiered approach, beginning with high-throughput screening methods followed by detailed mechanistic studies of variants showing significant phenotypes. This comprehensive methodology allows researchers to establish how different MC1R variants affect cellular responses to UV damage, providing insights into the mechanisms underlying increased melanoma risk associated with certain variants .

How do MC1R polymorphisms in primates correlate with evolutionary adaptations to UV exposure?

Investigating the relationship between MC1R polymorphisms in primates and evolutionary adaptations to UV exposure requires integrating comparative genomics, functional biology, and ecological data. Sequence comparison of MC1R across primate species, including humans, great apes, lesser apes (like Hylobates lar), and monkeys inhabiting different geographical regions and UV environments, can identify lineage-specific mutations and signatures of positive selection .

Geographical correlation studies mapping MC1R sequence variations against UV index data for the native habitats of different primate species can reveal whether species from high-UV environments show convergent adaptations despite phylogenetic distance. Functional characterization of species-specific variants through recombinant expression of MC1R proteins from different primates allows comparative assessment of ligand binding affinity, G-protein coupling efficiency, cAMP production, and UV response parameters.

Structural biology approaches using homology modeling based on recent GPCR crystal structures can help understand how species-specific amino acid changes affect receptor conformation and function. Molecular dynamics simulations can identify co-evolving residues that maintain structural integrity despite adaptive changes. Correlation with pigmentation patterns across primates should be analyzed, considering the protective role of eumelanin against UV damage.

Special attention should be given to the Hylobates lar MC1R as gibbons occupy a unique ecological niche in Southeast Asian forests with variable UV exposure . Comparing the recombinant Hylobates lar MC1R with human MC1R variants in functional assays measuring responses to UV exposure can provide insights into evolutionary adaptations specific to each species. This research approach can reveal how different primates have evolved MC1R variants to adapt to their specific environmental UV challenges.

What are the optimal conditions for using recombinant Hylobates lar MC1R in ELISA-based experiments?

When using recombinant Hylobates lar MC1R in ELISA-based experiments, researchers should consider several critical parameters to ensure optimal results. Proper storage and handling of the protein is essential - the recombinant Hylobates lar MC1R protein should be stored at -20°C for general storage or -80°C for extended preservation . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they compromise protein integrity . The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability .

For coating conditions in ELISA plates, carbonate/bicarbonate buffer (pH 9.6) typically works well for most recombinant proteins. The optimal coating concentration should be determined through titration experiments, usually starting with 1-5 μg/ml. Coating can be performed either at 4°C overnight or 37°C for 2 hours, with the former often yielding more consistent results. Blocking with 1-5% BSA or non-fat milk in PBS or TBS-T helps minimize background signal.

For detection systems, if the recombinant MC1R contains a tag, corresponding anti-tag antibodies can be used. For direct detection of MC1R, validated anti-MC1R antibodies with confirmed cross-reactivity to Hylobates lar MC1R should be employed. As a membrane protein, MC1R may require special considerations for maintaining native conformation in ELISA formats. Mild non-ionic detergents (0.1% Triton X-100 or 0.05% DDM) may help maintain protein structure without denaturing epitopes required for antibody recognition.

What controls should be included when studying MC1R-mediated DNA repair pathways?

When investigating MC1R-mediated DNA repair pathways, comprehensive controls are essential to ensure valid and interpretable results. Genetic controls should include wild-type MC1R expressing cells as positive controls, MC1R-null or silenced cells as negative controls , and cells expressing known loss-of-function MC1R variants (e.g., R151C, R160W, D294H) as comparative controls . Isogenic cell lines differing only in MC1R status eliminate confounding genetic variables.

Treatment controls must include unirradiated cells to establish baseline DNA damage and repair capacity, UV dose series to establish dose-response relationships, and positive controls for DNA damage (e.g., H₂O₂ for oxidative damage). Timing controls with samples collected at multiple time points post-UV capture repair kinetics. Signaling pathway controls should include α-MSH treated cells to maximize MC1R activation , forskolin-treated cells to directly activate adenylyl cyclase (bypassing MC1R), and palmitoylation inhibitors (e.g., 2-BrP) to assess palmitoylation dependence .

DNA repair pathway controls should incorporate cells deficient in specific repair pathways and specific DNA repair inhibitors to dissect the mechanisms involved. Technical controls for immunofluorescence studies of DNA damage should include secondary antibody-only controls, while comet assays should include internal standards with known DNA damage levels. Functional validation controls should feature rescue experiments with reintroduction of wild-type MC1R into MC1R-deficient cells and domain-specific mutants to identify regions of MC1R critical for DNA repair function.

How can researchers effectively silence MC1R expression to study its protective functions?

Effective silencing of MC1R expression is critical for studying its protective functions, particularly against UV-induced damage. RNA interference (RNAi) using short interfering RNA (siRNA) targeting MC1R mRNA can be transfected into melanocytes for transient knockdown . Multiple siRNAs targeting different regions of MC1R should be tested to identify those with highest efficiency and specificity. For longer-term silencing, short hairpin RNA (shRNA) expression constructs delivered via lentiviral vectors enable stable integration and constitutive MC1R knockdown.

CRISPR-Cas9 gene editing offers more permanent approaches, including complete knockout through guide RNAs targeting early exons of MC1R to create frameshift mutations. Domain-specific mutations can be introduced using CRISPR-Cas9 with homology-directed repair to disrupt particular functions while preserving others. Inducible CRISPR systems allow temporal control over MC1R disruption, useful for studying acute effects.

When designing silencing experiments, timing is crucial - for UV protection studies, MC1R silencing must be established before UV exposure . Specificity controls through rescue experiments with RNAi-resistant MC1R constructs help rule out off-target effects. Pathway validation should confirm that downstream signaling (cAMP production, CREB phosphorylation) is appropriately reduced. Phenotypic validation, such as altered melanin production, should verify expected phenotypes before proceeding to protective function studies.

In published studies, MC1R silencing has successfully demonstrated its role in protecting against UV-induced chromosome instability, with silenced cells showing increased cytogenetic alterations, centromeric fragmentations, and compromised DNA repair after UVB exposure .

What techniques are most reliable for measuring MC1R-mediated cAMP production?

Reliable measurement of MC1R-mediated cAMP production is fundamental to understanding receptor function, as the cAMP pathway is the primary signaling cascade activated by MC1R . Several complementary techniques offer advantages for different experimental contexts. Traditional approaches include Radioimmunoassay (RIA) and Enzyme Immunoassay (EIA), which use competitive binding between labeled and unlabeled cAMP for antibody recognition. These well-established, quantitative methods are suitable for large sample numbers but require cell lysis and provide only endpoint measurements.

ELISA-based cAMP detection kits using specific anti-cAMP antibodies with colorimetric, fluorescent, or chemiluminescent detection offer standardized protocols with good sensitivity and specificity. When selecting commercial kits, researchers should choose those validated for melanocyte samples and use standard curves with appropriate ranges for expected cAMP concentrations.

Real-time cAMP sensors, including FRET or BRET-based genetically encoded sensors expressed in live cells, provide important advantages for studying MC1R function. These approaches allow real-time measurements with spatial resolution of cAMP in different cellular compartments and can detect transient responses. Examples include EPAC-based sensors (EPAC1-camps, EPAC2-camps) or PKA-based sensors that undergo conformational changes upon cAMP binding.

When studying MC1R specifically, protocols should include appropriate controls to distinguish receptor-mediated effects from other sources of cAMP production. These include forskolin (direct adenylyl cyclase activator) as a positive control, MC1R antagonists or siRNA-mediated knockdown as negative controls, and comparison with cells expressing non-functional MC1R variants .

How should researchers design experiments to compare wild-type and variant MC1R function?

Designing robust experiments to compare wild-type and variant MC1R function requires careful consideration of cellular models, experimental conditions, and functional readouts. For cellular model selection, heterologous expression systems like HEK293 or CHO cells provide a clean background without endogenous MC1R, ideal for direct comparison of receptor variants . More physiologically relevant melanocyte models include primary human melanocytes with different natural MC1R genotypes, immortalized melanocyte lines with CRISPR-edited MC1R loci, or melanocytes from MC1R-null backgrounds with reintroduced wild-type or variant receptors.

Expression control strategies should utilize isogenic cell lines differing only in MC1R variant status. Inducible expression systems allow researchers to titrate receptor expression levels, ensuring comparable surface expression between variants. Fluorescent or epitope tagging helps monitor receptor localization and expression levels, while flow cytometry or cell surface biotinylation can quantify surface expression differences.

Functional assessment parameters should include ligand binding through saturation and competition binding assays with labeled α-MSH to determine affinity constants. cAMP production should be assessed via dose-response curves with α-MSH stimulation to determine EC50 and maximal response . Downstream signaling measurements should include CREB phosphorylation, MITF induction, and tyrosinase upregulation. Constitutive activity can be assessed by measuring baseline cAMP in the absence of ligand and response to inverse agonists like ASIP . UV response parameters should include DNA damage accumulation, repair kinetics, and chromosome stability .

Multiple MC1R variants should be included, representing different functional categories: RHC variants with severe loss of function (R151C, R160W, D294H) , variants with partial function, and common polymorphisms without significant functional impact. Testing variants in combination is important, as MC1R variants can occur as compound heterozygotes in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.