Recombinant Hylobates lar NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant MT-ND3

Recombinant MT-ND3 is a full-length, His-tagged protein derived from the mitochondrial genome of Hylobates lar (white-handed gibbon). It is a core subunit of Complex I (NADH:ubiquinone oxidoreductase), which catalyzes electron transfer from NADH to ubiquinone in the mitochondrial electron transport chain . This recombinant variant is expressed in E. coli systems for research applications, enabling studies on mitochondrial dysfunction and associated diseases .

Expression and Purification

Recombinant MT-ND3 is produced in E. coli systems, followed by affinity chromatography using His-tag purification. Key steps include:

  • Reconstitution: Lyophilized powder is resuspended in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Yield: Typically 0.5–2 mg/L culture, depending on expression conditions .

  • Quality Control: Verified via SDS-PAGE and mass spectrometry .

Role in Complex I Assembly:

  • MT-ND3 is essential for catalytic activity of Complex I; its absence disrupts assembly of the 950-kDa holoenzyme .

  • The A47T mutation (caused by 10197G>A in mtDNA) impairs hydrophobic interactions, leading to Leigh syndrome and mitochondrial encephalopathies .

Functional Domains:

  • Transmembrane Helices: Critical for proton channel formation .

  • Ubiquinone-Binding Site: Facilitates electron transfer from FMN to ubiquinone .

Associated Diseases:

ConditionPathogenic MechanismCitations
Leigh syndromeImpaired complex I activity due to ND3 mutations
Parkinson’s diseaseMitochondrial ROS accumulation from defective ND3
DystoniaHeteroplasmic 10197G>A mutation in ND3

Research Tools:

  • Antibodies: Rabbit polyclonal anti-MT-ND3 antibodies (e.g., ab192306, ab204977) validated for WB, IHC, and ICC/IF .

  • ELISA Kits: Available for quantitative analysis (e.g., CSB-CF839170HXW-GB) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Hylobates lar (Common gibbon) (White-handed gibbon)
Target Names
Target Protein Sequence
MNLALALMINTLLALLLMTITFWLPQLNTYMEKTNPYECGFDPLSPARIPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNPSLTIASSLTLITILILSLAYEWSQKGLDWVE
Uniprot No.

Target Background

Function

Recombinant Hylobates lar NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. MT-ND3 is essential for the catalytic activity of Complex I.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a protein encoded by the mitochondrial gene MT-ND3. It functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex is critical for cellular respiration, as it catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q), which is a mobile carrier in the inner mitochondrial membrane . This electron transfer is coupled with the translocation of approximately four protons across the inner mitochondrial membrane into the intermembrane space, contributing to the establishment of a proton gradient that drives ATP synthesis2.

Within Complex I, MT-ND3 works alongside approximately 19 other membrane-bound proteins. The complex contains proteins with iron-sulfur clusters and a flavin group, which facilitate electron transfer. After receiving electrons, the mobile electron carrier ubiquinone diffuses away to transfer its electrons to the next complex in the respiratory chain2.

How does Hylobates lar MT-ND3 differ from MT-ND3 in other primates?

Hylobates lar (white-handed gibbon) MT-ND3 has been sequenced as part of mitochondrial genome studies, with the complete mtDNA sequence available in GenBank (accession number X99256) . Comparative analyses of the MT-ND3 region across primate species reveal evolutionary relationships and species-specific adaptations.

Studies examining the mitochondrial ND3-ND4 region in gibbons have shown significant sequence variation across the Hylobatidae family. Within-genus uncorrected sequence divergence means in the Hylobates genus (which includes H. lar) are approximately 0.059970 (range: 0.00000-0.09156), indicating considerable genetic diversity . This variation reflects the evolutionary history of gibbons and their adaptation to different ecological niches.

The phylogenetic analysis of MT-ND3 and related mitochondrial genes has been instrumental in resolving the species-level relationships among hylobatids, confirming the monophyly of the four recognized genera: Nomascus, Bunopithecus, Symphalangus, and Hylobates .

What experimental techniques are most effective for expressing recombinant Hylobates lar MT-ND3?

Recombinant expression of Hylobates lar MT-ND3 presents several challenges due to its hydrophobic nature and mitochondrial origin. Based on established methodologies for similar mitochondrial proteins, the following approaches are recommended:

  • Expression Systems Selection:

    • Bacterial systems (E. coli): Suitable for initial expression attempts due to rapid growth and high yield, but may require optimization to address inclusion body formation

    • Yeast systems (S. cerevisiae, P. pastoris): Provide eukaryotic processing capabilities while maintaining relatively high yields

    • Baculovirus-insect cell systems: Often preferred for mitochondrial membrane proteins due to proper folding and post-translational modifications

    • Mammalian cell systems: Most physiologically relevant but typically lower yields

  • Optimization Strategies:

    • Codon optimization for the expression host

    • Fusion with solubility tags (MBP, SUMO, Trx)

    • Expression at lower temperatures (16-20°C)

    • Use of specialized E. coli strains (C41, C43) designed for membrane protein expression

  • Purification Approaches:

    • Detergent-based extraction (DDM, LMNG, or digitonin)

    • Affinity chromatography using engineered tags

    • Size exclusion chromatography for final polishing

Based on protocols used for similar mitochondrial proteins, a two-step purification process combining affinity chromatography with size exclusion often yields the purest protein preparations.

How can researchers effectively study the structure-function relationship of Hylobates lar MT-ND3 within Complex I?

Studying the structure-function relationship of Hylobates lar MT-ND3 requires an integrated approach combining structural biology, biochemistry, and functional analyses:

  • Structural Analysis Approaches:

    • Cryo-electron microscopy (cryo-EM) has become the method of choice for Complex I structural studies, enabling visualization of the protein in near-native conditions

    • X-ray crystallography, though challenging with membrane proteins, can provide high-resolution structural information when successful

    • NMR spectroscopy for specific domains or peptide segments of MT-ND3

    • In silico modeling based on homologous structures from other species

  • Functional Characterization Methods:

    • Site-directed mutagenesis to identify critical residues

    • Complex I activity assays measuring NADH:ubiquinone oxidoreductase activity

    • Proton pumping assays using reconstituted proteoliposomes

    • Measurements of ROS production to assess electron leakage

  • Integration with Whole Complex Studies:

    • Reconstitution of MT-ND3 with other Complex I subunits

    • Assembly studies using pulse-chase experiments

    • Blue native PAGE analysis to examine complex formation

    • Interaction studies using crosslinking mass spectrometry

A comprehensive understanding requires examining MT-ND3 both in isolation and within the context of the entire Complex I, with particular attention to interfaces with other subunits and involvement in proton translocation pathways.

What are the implications of MT-ND3 mutations identified in Hylobates lar for understanding human mitochondrial diseases?

MT-ND3 mutations in humans have been associated with various mitochondrial disorders, including Leigh syndrome, MELAS, and sensorimotor axonal polyneuropathy . Studying homologous mutations in Hylobates lar MT-ND3 can provide valuable insights into disease mechanisms and potential therapeutic approaches.

Comparative analysis of pathogenic mutations can reveal:

  • Conservation of Critical Residues:

    • Highly conserved residues across species that, when mutated, lead to similar biochemical defects

    • Species-specific differences that may explain variable disease expression

  • Functional Consequences:

    • Impact on Complex I assembly and stability

    • Effects on electron transport efficiency

    • Changes in proton pumping capacity

    • Increased reactive oxygen species (ROS) production

  • Cellular Adaptations:

    • Compensatory mechanisms that may mitigate the effects of mutations

    • Tissue-specific responses to mitochondrial dysfunction

A notable example comes from human studies where a novel mutation m.10372A>G in MT-ND3 was identified in a patient with adult-onset sensorimotor axonal polyneuropathy. Muscle tissue analysis revealed ragged red fibers, paracrystalline inclusions, significant reduction in Complex I respiratory chain activity, and decreased ATP production for all substrates used by Complex I . Similar functional studies in Hylobates lar models could help identify conserved pathogenic mechanisms.

How can heterologous expression systems be optimized for studying the functional aspects of recombinant Hylobates lar MT-ND3?

Optimizing heterologous expression systems for functional studies of recombinant Hylobates lar MT-ND3 requires addressing several challenges specific to mitochondrial membrane proteins:

  • Expression System Selection and Optimization:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effective, rapidLacks post-translational modifications, forms inclusion bodiesLow temperature induction (16-20°C), specialized strains (C41/C43), fusion tags
YeastEukaryotic processing, moderate yieldDifferences in membrane compositionCodon optimization, inducible promoters, cultivation parameter adjustment
Insect cellsGood folding, post-translational modificationsLonger production time, higher costBaculovirus titer optimization, harvest time determination
Mammalian cellsMost native-like conditionsLowest yield, highest costStable cell line generation, bioreactor cultivation
  • Functional Reconstitution Approaches:

    • Incorporation into nanodiscs or liposomes to mimic native membrane environment

    • Co-expression with interacting partners from Complex I

    • Development of cell-free expression systems with direct incorporation into artificial membranes

  • Activity Assessment Methods:

    • Spectrophotometric assays measuring NADH oxidation

    • Electron transfer measurements using artificial electron acceptors

    • Membrane potential measurements in reconstituted systems

    • Oxygen consumption rates in whole cells or isolated mitochondria

  • Validation Strategies:

    • Comparison with native Complex I isolated from Hylobates lar tissue

    • Complementation studies in Complex I-deficient cell lines

    • Response to known Complex I inhibitors and activators

The most successful approaches typically combine mammalian expression systems for structural studies with bacterial systems for mutagenesis and initial functional characterization, followed by validation in more physiologically relevant models.

What methodologies can be employed to study the interaction between Hylobates lar MT-ND3 and other subunits of Complex I?

Understanding the interactions between MT-ND3 and other Complex I subunits is crucial for elucidating the assembly, stability, and function of this important respiratory complex. Several complementary methodologies can be employed:

  • Physical Interaction Studies:

    • Cross-linking mass spectrometry (XL-MS) to identify amino acid residues in close proximity

    • Co-immunoprecipitation with antibodies specific to MT-ND3 or other subunits

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding parameters

    • FRET or BRET assays for proximity detection in living cells

  • Assembly Pathway Analysis:

    • Pulse-chase labeling to track incorporation of MT-ND3 into Complex I

    • Blue native PAGE combined with western blotting to visualize assembly intermediates

    • Protein import assays in isolated mitochondria

    • Time-course analysis of complex formation using inducible expression systems

  • Structural Biology Approaches:

    • Cryo-EM of intact Complex I at various stages of assembly

    • Hydrogen/deuterium exchange mass spectrometry to map interaction surfaces

    • Computational docking and molecular dynamics simulations

    • NMR studies of isotopically labeled domains

  • Functional Interaction Assessment:

    • Mutagenesis of putative interaction sites followed by activity assays

    • Suppressor mutation analysis to identify compensatory changes

    • Construction of chimeric proteins to map functional interaction domains

    • Thermal stability assays to assess complex integrity

The integration of these approaches can generate a comprehensive understanding of how MT-ND3 contributes to Complex I architecture and function, potentially revealing species-specific adaptations in Hylobates lar compared to other primates.

How do heteroplasmy levels of MT-ND3 mutations affect phenotypic expression in primate models?

Heteroplasmy—the presence of both wild-type and mutant mitochondrial DNA within cells—is a critical factor in determining the phenotypic expression of mitochondrial mutations. Studies involving primates, including Hylobates species, provide valuable insights into this phenomenon.

  • Heteroplasmy Quantification Methods:

    • Last-cycle hot PCR is a validated method for quantifying heteroplasmic levels of mutated mtDNA in different tissues

    • Next-generation sequencing allows for high-throughput and highly sensitive detection of low-level heteroplasmy

    • Digital droplet PCR provides absolute quantification of mutant versus wild-type mtDNA

    • Pyrosequencing offers rapid quantification with moderate sensitivity

  • Tissue-Specific Heteroplasmy Patterns:

    • Human studies have demonstrated that heteroplasmy levels can vary significantly between tissues

    • In a study of a novel MT-ND3 mutation causing sensorimotor axonal polyneuropathy, cultured myoblasts did not carry the mutation that was present in skeletal muscle, and consequently showed normal respiratory chain activity

    • This tissue-specific distribution of mutant mtDNA contributes to the varied clinical manifestations of mitochondrial disorders

  • Threshold Effects:

    • Biochemical defects typically manifest when the proportion of mutant mtDNA exceeds a tissue-specific threshold

    • For MT-ND3 mutations, this threshold may vary depending on the specific mutation and tissue energy requirements

    • Tissues with high energy demands, such as muscle and nervous tissue, generally display symptoms at lower heteroplasmy levels

  • Research Applications:

    • Studying heteroplasmy dynamics in Hylobates lar could provide evolutionary insights into mitochondrial selection pressures

    • Comparing heteroplasmy thresholds across primate species may reveal species-specific adaptations in mitochondrial function

    • Such comparative studies could inform the development of therapeutic approaches for human mitochondrial disorders

Understanding heteroplasmy is essential for interpreting experimental results involving MT-ND3 mutations and for developing accurate disease models.

How can Hylobates lar MT-ND3 research contribute to conservation efforts for endangered gibbon species?

Research on Hylobates lar MT-ND3 and other mitochondrial genes has significant implications for gibbon conservation efforts. Gibbons are among the most endangered primates, threatened by habitat loss, fragmentation, hunting, and illegal trade . MT-ND3 research contributes to conservation in several ways:

  • Taxonomic Clarification and Evolutionary History:

    • Mitochondrial gene analysis, including MT-ND3, has helped establish the phylogenetic relationships among hylobatids, confirming four distinct genera: Nomascus, Bunopithecus, Symphalangus, and Hylobates

    • This taxonomic clarity is essential for developing species-specific conservation strategies

    • Understanding the evolutionary history of gibbons provides context for current distribution patterns and genetic diversity

  • Population Genetics and Diversity Assessment:

    • MT-ND3 sequences can be used as markers to assess genetic diversity within populations

    • Within-genus uncorrected sequence divergence in Hylobates has been measured at approximately 0.059970 (range: 0.00000-0.09156) , indicating considerable genetic diversity that should be preserved

    • Molecular data helps identify genetically distinct populations that require targeted conservation efforts

  • Health Monitoring and Disease Susceptibility:

    • Understanding the function of MT-ND3 and potential impact of mutations provides insight into energy metabolism in gibbons

    • This knowledge can inform veterinary care for captive populations and rehabilitation efforts

    • Comparative studies may reveal species-specific adaptations that influence habitat requirements

  • Forensic Applications:

    • MT-ND3 sequences can be used to identify the species origin of gibbon specimens in illegal wildlife trade

    • This supports law enforcement efforts to combat poaching and trafficking of these endangered primates

Conservation strategies informed by molecular genetic data, including MT-ND3 research, are more likely to succeed in preserving the genetic diversity and evolutionary potential of gibbon populations.

What are the most promising techniques for investigating the role of MT-ND3 in oxidative stress response?

Investigating the role of MT-ND3 in oxidative stress response is crucial for understanding mitochondrial dysfunction in both normal aging and pathological conditions. The following techniques offer powerful approaches:

  • Real-time ROS Detection Methods:

    • Fluorescent probes (DCF-DA, MitoSOX Red) for live-cell imaging of ROS production

    • Genetically encoded redox sensors (roGFP, HyPer) for compartment-specific measurements

    • Electron paramagnetic resonance (EPR) spectroscopy for direct detection of free radicals

    • Protein carbonylation assays to measure oxidative damage to proteins

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9-mediated introduction of specific MT-ND3 mutations

    • Cybrid cell models containing different levels of mutant mtDNA

    • Inducible expression systems to control MT-ND3 variant expression

    • RNA interference to modulate expression of nuclear-encoded Complex I assembly factors

  • Biochemical Analysis Techniques:

    • Isolated mitochondria respiration measurements using Seahorse XF analyzers

    • Complex I enzyme activity assays under varying oxidative conditions

    • Redox state analysis of NAD+/NADH and glutathione pools

    • Lipid peroxidation assessment using TBARS or 4-HNE immunodetection

  • Systems Biology Approaches:

    • Transcriptomics to identify changes in stress response pathways

    • Proteomics to detect post-translational modifications related to oxidative stress

    • Metabolomics focusing on redox-sensitive metabolites

    • Integration of multiple omics data to model cellular responses

These techniques, applied to Hylobates lar MT-ND3 variants, can reveal the specific contribution of this subunit to ROS generation and management, potentially identifying species-specific adaptations in oxidative stress handling that could inform human disease research.

How can comparative studies between human and Hylobates lar MT-ND3 advance our understanding of mitochondrial disease mechanisms?

Comparative studies between human and Hylobates lar MT-ND3 provide valuable insights into mitochondrial disease mechanisms, offering evolutionary perspectives that can enhance our understanding of pathogenicity:

  • Evolutionary Conservation Analysis:

    • Identification of highly conserved residues that, when mutated, are likely to cause dysfunction

    • Recognition of species-specific variations that may represent adaptive changes

    • Understanding functional constraints on MT-ND3 across primate evolution

  • Structure-Function Comparisons:

    • Mapping disease-causing mutations onto structural models of both human and Hylobates lar MT-ND3

    • Identifying differences in amino acid composition at key functional sites

    • Analyzing how species-specific variations might influence Complex I assembly and function

  • Physiological Adaptation Studies:

    • Investigating differences in mitochondrial function that might reflect adaptations to different environmental niches

    • Exploring potential correlations between MT-ND3 sequence variations and metabolic requirements

    • Examining how differences in nuclear-encoded Complex I subunits interact with MT-ND3 variants

  • Experimental Disease Models:

    • Development of cell lines expressing Hylobates lar MT-ND3 variants in human nuclear backgrounds

    • Introduction of human disease-associated mutations into Hylobates lar MT-ND3 to assess functional impacts

    • Comparative analysis of heteroplasmy thresholds for biochemical defects across species

A case study highlighting the value of such comparative approaches involves a novel m.10372A>G mutation in human MT-ND3, which causes sensorimotor axonal polyneuropathy . By examining whether equivalent mutations in Hylobates lar MT-ND3 produce similar biochemical defects, researchers can gain insights into the evolutionary conservation of mitochondrial disease mechanisms and potentially identify species-specific protective factors.

What are the recommended approaches for investigating MT-ND3 involvement in neurodegenerative processes?

MT-ND3 mutations have been implicated in neurological disorders, including a reported case of sensorimotor axonal polyneuropathy . Investigating the role of MT-ND3 in neurodegenerative processes requires specialized approaches:

  • Neuronal Model Systems:

    • iPSC-derived neurons carrying MT-ND3 mutations

    • Primary neuronal cultures from transgenic animal models

    • Organoid models incorporating MT-ND3 variants

    • Ex vivo brain slice cultures for acute manipulation of mitochondrial function

  • Functional Assessments in Neuronal Context:

    • Electrophysiological recordings to assess neuronal activity

    • Calcium imaging to evaluate intracellular calcium dynamics

    • Axonal transport assays to examine mitochondrial trafficking

    • Neurite outgrowth and synaptogenesis quantification

  • Neurodegeneration-Specific Analyses:

    • Assessment of mitochondrial membrane potential in neurites

    • Quantification of synaptic mitochondria morphology and function

    • Examination of mitochondrial quality control mechanisms

    • Analysis of neuron-specific metabolic requirements and adaptations

  • Translational Research Approaches:

    • Correlation of MT-ND3 variant effects with clinical neurological findings

    • Development of neuroprotective strategies targeting Complex I dysfunction

    • Biomarker identification for early detection of neurodegeneration

    • Therapeutic approaches to enhance mitochondrial function in neurons

These methodologies should be applied with consideration of the unique aspects of neuronal biology, including:

  • High energy demands and reliance on oxidative phosphorylation

  • Complex morphology requiring mitochondrial trafficking over long distances

  • Specialized synaptic compartments with local energy needs

  • Vulnerability to excitotoxicity and oxidative stress

The findings from such studies could have significant implications for understanding and treating mitochondrial neuropathies and potentially broader neurodegenerative conditions.

What are the emerging technologies that will advance Hylobates lar MT-ND3 research in the next decade?

The future of Hylobates lar MT-ND3 research will be shaped by several emerging technologies that promise to enhance our understanding of mitochondrial function and evolution:

  • Advanced Imaging Technologies:

    • Cryo-electron tomography for visualizing Complex I in situ

    • Super-resolution microscopy techniques for tracking single Complex I molecules

    • Label-free imaging methods for non-invasive mitochondrial assessment

    • Correlative light and electron microscopy for structure-function studies

  • Genome Editing and Synthetic Biology:

    • Base editing and prime editing for precise mtDNA modification

    • Mitochondria-targeted nucleases for heteroplasmy shifting

    • Synthetic organelle systems to reconstitute minimal functional units

    • Allotopic expression of mitochondrial genes from the nucleus

  • Single-Cell and Spatial Technologies:

    • Single-cell transcriptomics and proteomics to examine cell-to-cell variability

    • Spatial metabolomics to map metabolic activity within tissues

    • Multi-omics integration at single-cell resolution

    • In situ sequencing for heteroplasmy mapping within tissues

  • Computational and AI Approaches:

    • Deep learning for predicting mutational impacts on protein function

    • Molecular dynamics simulations with enhanced sampling techniques

    • Systems biology modeling of mitochondrial energy metabolism

    • Comparative genomics across primates for evolutionary insights

These technologies will enable researchers to address fundamental questions about MT-ND3 function, evolution, and role in disease with unprecedented precision and contextual understanding, potentially leading to novel therapeutic strategies for mitochondrial disorders.

How can researchers effectively address the technical challenges in studying mitochondrially encoded proteins like MT-ND3?

Studying mitochondrially encoded proteins like MT-ND3 presents unique technical challenges that require specialized approaches:

  • Genetic Manipulation Strategies:

    • Cybrid technology to introduce mitochondrial mutations into controlled nuclear backgrounds

    • Mitochondria-targeted nucleases (mitoTALENs, mitoCRISPR) for specific mtDNA editing

    • Allotopic expression of recoded MT-ND3 from the nucleus with mitochondrial targeting

    • RNA import strategies to introduce modified mRNAs into mitochondria

  • Protein Expression and Purification:

    • Cell-free expression systems with membrane-mimetic environments

    • Co-expression with interacting partners to stabilize the protein

    • Native purification of entire Complex I followed by subunit isolation

    • Development of amphipathic environments that maintain protein structure

  • Functional Assessment Innovations:

    • Label-free activity assays to avoid interference with protein function

    • Real-time monitoring of multiple parameters simultaneously

    • In-organello translation systems to study protein synthesis

    • Microfluidic platforms for high-throughput functional screening

  • Structural Biology Advancements:

    • Novel membrane mimetics that better represent the mitochondrial inner membrane

    • Integration of computational prediction with experimental validation

    • Fragment-based approaches for difficult-to-crystallize regions

    • Time-resolved structural studies to capture dynamic states

By addressing these technical challenges, researchers can overcome the traditional barriers to studying mitochondrially encoded proteins, leading to more comprehensive insights into MT-ND3 function in both normal physiology and disease states across primate species, including Hylobates lar.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.