Recombinant Hylobates muelleri Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Hylobates muelleri (Mueller's Bornean gibbon)
Target Names
Target Protein Sequence
MAVQGFQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV ATIAKNRNLHSPTYCFICCLALSDLLVSGGNVLETVVILLLEASALAARAAVVQPLDNVI DVITCSSMVSSLCFLGAIAVDRYVSIFYALRYHSIVTLPRARQAIAAIWVASVLFSTLFI AYYDHAAVLLCLVVFFLAMLVXMAVLYVHMLARACQHAQGIARLHKRQRPLHQGFGLKGA VTLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RRQELRRTLKEGLTCSW
Uniprot No.

Target Background

Function

The melanocyte-stimulating hormone receptor (MC1R) is a receptor for α-, β-, and γ-MSH and ACTH. Its activity is G protein-mediated, activating adenylate cyclase. MC1R regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow) pigments, through cAMP signaling in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Hylobates muelleri MC1R and how does it compare to other primate MC1R proteins?

The Melanocortin-1 Receptor (MC1R) in Mueller's gibbon (Hylobates muelleri) is a G protein-coupled receptor that plays a role in regulating pigmentation. Comparative analysis of MC1R amino acid sequences across nine non-human primate species has revealed important structural similarities and differences . While specific amino acid sequence details for H. muelleri MC1R are documented in research databases, the protein maintains the characteristic seven-transmembrane domain structure common to all melanocortin receptors. When compared with closely related species such as white-cheeked gibbons (Nomascus leucogenys) and lar gibbons (Hylobates lar), the Mueller's gibbon MC1R shows high sequence conservation in functional domains, particularly in regions responsible for ligand binding and G-protein coupling.

How does the signaling cascade of Mueller's gibbon MC1R function compared to human MC1R?

The MC1R signaling pathway in Mueller's gibbon likely follows the canonical mechanism observed in other mammals. When the receptor binds α-melanocyte-stimulating hormone (α-MSH), it activates adenylyl cyclase, which produces cyclic adenosine monophosphate (cAMP) . This increased cAMP concentration triggers various intracellular molecular pathways that promote melanin synthesis and influence the eumelanin to pheomelanin ratio .

While primate MC1R research suggests conservation of core signaling mechanisms across species, the extent of functional differences between human and Mueller's gibbon MC1R remains an area requiring further investigation. Based on comparative studies of primate MC1R sequences, researchers have noted variations in specific amino acid residues that may affect binding affinity for ligands or coupling efficiency with signaling proteins, potentially leading to species-specific differences in receptor sensitivity and melanogenic response.

What evidence exists for the role of Mueller's gibbon MC1R in pigmentation phenotypes?

Interestingly, comparative studies of MC1R sequences across multiple non-human primate species, including Mueller's gibbon, suggest that MC1R may not play a prominent role in sexual dichromatism (pigmentation differences between males and females) in these primates . This finding contrasts with the well-established role of MC1R variants in human pigmentation, where specific polymorphisms are strongly associated with fair skin, red hair, and freckling .

The research indicates that despite MC1R's importance in human pigmentation, other genetic factors may be more significant determinants of pelage coloration in gibbons and other non-human primates. This suggests evolutionary divergence in the genetic control of pigmentation across primate lineages, with MC1R playing varying roles depending on the species.

What are the optimal expression systems for producing recombinant Mueller's gibbon MC1R?

For recombinant production of Mueller's gibbon MC1R, researchers typically employ mammalian expression systems to ensure proper post-translational modifications and membrane integration. While bacterial expression systems like E. coli might yield higher protein quantities, they often fail to properly fold complex membrane proteins like MC1R.

HEK293 or CHO cell lines serve as preferred expression platforms due to their ability to process the protein through the mammalian secretory pathway. For functional studies, researchers typically clone the full-length Mueller's gibbon MC1R coding sequence into mammalian expression vectors containing strong constitutive promoters (such as CMV) and appropriate selection markers. Transient transfection protocols using lipid-based reagents or electroporation can achieve expression for short-term studies, while stable cell lines are generated using antibiotic selection for long-term investigations of receptor function.

When designing expression constructs, researchers should consider incorporating epitope tags (such as FLAG or His-tag) at the N-terminus or in an extracellular loop to facilitate detection and purification without interfering with receptor function.

What techniques are most effective for validating the functional activity of recombinant Mueller's gibbon MC1R?

Multiple complementary approaches are necessary to validate recombinant MC1R functionality:

  • Ligand binding assays: Competitive binding assays using radiolabeled or fluorescently labeled α-MSH derivatives can determine binding affinity (Kd) and specificity.

  • cAMP accumulation assays: Since MC1R signals through adenylyl cyclase activation, measuring intracellular cAMP levels following ligand stimulation provides direct evidence of functional activity. Researchers typically use ELISA-based detection methods or genetically encoded FRET-based cAMP sensors.

  • Calcium mobilization assays: Though secondary to cAMP signaling, calcium flux can be measured using fluorescent indicators like Fura-2 to further characterize receptor coupling to downstream pathways.

  • Rescue experiments: Similar to the zebrafish morpholino experiments described for other species, functional validation can be performed by testing whether the recombinant Mueller's gibbon MC1R can rescue phenotypes in systems where endogenous MC1R function has been knocked down . This approach provides strong evidence of in vivo functionality.

  • Microscopy-based trafficking studies: Confocal microscopy of fluorescently tagged receptor constructs helps determine proper membrane localization, which is essential for function.

How can researchers overcome challenges in membrane protein solubilization when purifying recombinant Mueller's gibbon MC1R?

Purification of membrane proteins like MC1R presents significant challenges due to their hydrophobic nature. Effective strategies include:

  • Detergent screening: Systematic testing of detergents (including DDM, LMNG, and digitonin) at varying concentrations to identify optimal solubilization conditions that maintain protein stability and function.

  • Amphipol substitution: After initial detergent solubilization, substituting with amphipathic polymers (amphipols) can improve stability for structural studies.

  • Nanodiscs incorporation: Reconstitution into phospholipid nanodiscs provides a near-native membrane environment, particularly valuable for functional studies.

  • Fusion protein approaches: N-terminal fusion with soluble partners like maltose-binding protein can improve expression and solubility.

  • Thermostability engineering: Introduction of stabilizing mutations based on comparative sequence analysis across primate MC1R variants may enhance protein stability during purification.

For MC1R specifically, mild solubilization conditions using digitonin or LMNG at concentrations just above their critical micelle concentration, combined with the presence of cholesterol and a stabilizing ligand during extraction, often yields the best results.

How does Mueller's gibbon MC1R sequence differ from other non-human primate MC1R sequences?

Comparative analysis of MC1R amino acid sequences across nine non-human primate species reveals both conserved and variable regions. While exact percentage differences would require sequence alignment analysis, studies indicate that MC1R sequences show variability across primate species .

The following table summarizes some key comparative aspects of MC1R across primate species studied:

SpeciesCommon NameMC1R Sequence LengthSexual DichromatismNotable Sequence Features
Hylobates muelleriMueller's gibbonComplete sequence documented in databasesNoPart of monochromatic gibbon group
Hylobates larLar gibbonSimilar to other gibbonsYesShows sequence divergence in specific regions
Nomascus leucogenysWhite-cheeked gibbonComplete sequence documentedYesContains sexually dichromatic variants
Pan troglodytesChimpanzeeComplete sequence documentedNoHigh homology with human MC1R
Alouatta carayaBlack howler monkeyComplete sequence documentedYesShows sexual dichromatism
Alouatta palliataMantled howler monkeyComplete sequence documentedNoMonochromatic

Note that across these species, the MC1R gene appears to have both conserved regions (particularly in transmembrane domains and ligand binding sites) and variable regions that may contribute to species-specific responses to melanocortin peptides .

What evolutionary insights can be gained from studying polymorphisms in the Mueller's gibbon MC1R gene?

Studying polymorphisms in Mueller's gibbon MC1R provides valuable insights into primate evolution and adaptation:

  • Selection pressure analysis: The pattern of nonsynonymous versus synonymous substitutions in MC1R can reveal whether the gene has been under positive, negative, or neutral selection in the Mueller's gibbon lineage.

  • Convergent evolution assessment: Comparing functional polymorphisms across distantly related primates can identify instances of convergent evolution, where similar adaptive mutations arose independently.

  • Climate adaptation: MC1R variants may reflect adaptation to different UV exposure levels in ancestral habitats, with conservation of functional domains suggesting maintained importance of basic receptor function.

  • Sexual selection influences: The comparative analysis of sexually dichromatic and monochromatic primates suggests that, contrary to humans where MC1R strongly influences pigmentation, MC1R may not be the primary genetic determinant of sexual color differences in non-human primates .

Interestingly, research indicates that MC1R does not appear to play a prominent role in sexual dichromatism in non-human primates, suggesting alternative genetic pathways may be more important for pelage color variation in these species . This finding contrasts with the significant role MC1R plays in human pigmentation variation, pointing to divergent evolution of pigmentation control mechanisms across primate lineages.

What conserved regions of MC1R are most critical for functional studies across primate species?

Based on comparative sequence analysis of MC1R across primate species, several highly conserved regions have been identified as critical for receptor function. These regions should be the focus of mutagenesis studies and functional investigations:

  • Transmembrane domains: Particularly TM2, TM3, and TM7, which contain residues essential for G-protein coupling.

  • Ligand binding pocket: Formed by residues from multiple transmembrane domains, this region determines specificity and affinity for melanocortin peptides.

  • DRY motif: Located at the junction of TM3 and the second intracellular loop, this highly conserved motif is critical for G-protein activation.

  • N-terminal domain: Contains N-glycosylation sites important for receptor processing and cell surface expression.

  • Specific amino acid positions: Certain positions show strong conservation across all primate species, including positions homologous to human R142, R151, and R160, which when mutated in humans cause significant phenotypic effects . The R160W mutation in humans (homologous to position 164 in other species) has been particularly well-studied for its effects on receptor function .

The conservation of these regions across primate species, including Mueller's gibbon, suggests their fundamental importance for MC1R function and makes them prime targets for structure-function studies using recombinant protein systems.

How can researchers effectively measure cAMP responses to ligand binding in recombinant Mueller's gibbon MC1R systems?

Researchers can employ several methodologies to measure cAMP responses following ligand binding to recombinant Mueller's gibbon MC1R:

  • ELISA-based cAMP quantification: Commercial kits allow precise measurement of intracellular cAMP accumulation following receptor stimulation. This approach provides absolute quantification but requires cell lysis at discrete time points.

  • Real-time cAMP biosensors: Genetically encoded FRET-based sensors like EPAC-based constructs (e.g., EPAC-SH187) or Glosensor technology enable continuous, real-time monitoring of cAMP dynamics in living cells. These approaches are particularly valuable for capturing the kinetics of receptor activation and desensitization.

  • CRE-luciferase reporter assays: Since cAMP activates protein kinase A, which subsequently activates CREB transcription factor binding to CRE elements, CRE-driven luciferase reporters provide an amplified readout of receptor activation.

  • Patch-clamp electrophysiology: For measuring CFTR chloride channel activation downstream of cAMP production, providing high temporal resolution of signaling events.

  • Phospho-CREB immunoblotting: Detecting phosphorylation of CREB as a downstream readout of cAMP-PKA pathway activation.

When designing these experiments, researchers should include appropriate controls:

  • Positive controls using forskolin (direct adenylyl cyclase activator)

  • Concentration-response curves with α-MSH and related melanocortin peptides

  • Competitive antagonist studies with known MC1R antagonists

  • Comparisons with human MC1R or other primate MC1R variants to benchmark response magnitude and kinetics

These approaches allow quantitative characterization of receptor pharmacology, including EC50 values, maximal response capabilities, and signaling kinetics.

What are the methodological approaches for studying the effects of Mueller's gibbon MC1R variants on melanin synthesis?

To study how Mueller's gibbon MC1R variants affect melanin synthesis, researchers can employ several complementary approaches:

  • Heterologous expression in melanocyte cell lines: Transfecting MC1R-deficient melanocyte lines (such as melan-c) with wild-type or variant Mueller's gibbon MC1R constructs allows assessment of melanin production capacity. Melanin content can be quantified spectrophotometrically after cell lysis and melanin extraction.

  • Primary melanocyte cultures: Though technically challenging, isolation and culture of primary melanocytes from relevant species, followed by gene knockdown and replacement experiments, provides a more physiologically relevant system.

  • Zebrafish model system: As demonstrated in the research on other MC1R variants, morpholino knockdown in zebrafish followed by rescue with in vitro transcribed RNA from Mueller's gibbon MC1R variants allows in vivo assessment of pigmentation effects . This approach provides visual phenotypes that can be quantified through image analysis of melanophore density and melanin content.

  • Eumelanin/pheomelanin ratio quantification: High-performance liquid chromatography analysis of melanin types produced in cell culture systems expressing different MC1R variants can reveal shifts in melanin composition, which is a key phenotypic outcome of MC1R signaling.

  • Melanogenic gene expression profiling: qRT-PCR or RNA-seq analysis of key genes involved in melanin synthesis (TYR, TYRP1, DCT) following MC1R activation provides mechanistic insights into how receptor variants affect the melanogenic program.

The morpholino knockdown approach in zebrafish has been successfully used to study the effects of MC1R variants from other species, where injection of MC1R-targeted morpholinos resulted in reduced pigmentation, and this phenotype could be rescued by co-injection with functional MC1R RNA but not with RNA containing loss-of-function mutations .

How does the Mueller's gibbon MC1R response to UV radiation compare with human MC1R response?

  • UV-induced MC1R expression analysis: Quantitative PCR or RNA-seq analysis of MC1R expression in cultured keratinocytes or melanocytes expressing either human or recombinant Mueller's gibbon MC1R following UV exposure. This approach determines if transcriptional regulation differs between species.

  • Post-UV signaling dynamics: Cells expressing either receptor can be exposed to UV radiation, followed by assessment of cAMP accumulation, ERK activation, and other downstream signaling events. Time-course studies are particularly valuable for capturing differences in signaling magnitude and duration.

  • DNA damage response studies: Since MC1R plays a role in the cellular response to UV-induced DNA damage, comparing phospho-H2AX formation, nucleotide excision repair efficiency, and cell survival after UV exposure in cells expressing different MC1R variants provides functional insights.

  • Organotypic skin models: Three-dimensional skin reconstructs incorporating melanocytes expressing either human or Mueller's gibbon MC1R allow assessment of more complex tissue-level responses to UV, including paracrine signaling between keratinocytes and melanocytes.

Evidence suggests that MC1R upregulation in response to UV radiation enhances melanogenesis and melanin synthesis in humans . Whether Mueller's gibbon MC1R shows similar UV responsiveness remains to be comprehensively investigated, though the different UV exposure in the native habitats of these species might predict evolutionary differences in receptor regulation and function.

How can Mueller's gibbon MC1R research contribute to our understanding of pigmentation disorders?

Research on Mueller's gibbon MC1R can advance our understanding of pigmentation disorders through several avenues:

  • Evolutionary perspective on pathogenic variants: Comparing Mueller's gibbon MC1R with human MC1R can identify conserved residues where mutations are likely to be pathogenic versus positions where variation is tolerated. This evolutionary approach helps prioritize novel human variants for functional investigation.

  • Alternative signaling pathways: If Mueller's gibbon MC1R utilizes distinct signaling mechanisms or interaction partners, this could reveal compensatory pathways that might be therapeutically targeted in human pigmentation disorders.

  • Adaptation to UV exposure: Given the different habitats and UV exposure levels of gibbons versus humans, comparing MC1R function between species can reveal adaptive mechanisms that may inform therapeutic approaches for hypopigmentation disorders or UV hypersensitivity conditions.

  • Gene-gene interactions: Studying how MC1R interacts with other pigmentation genes in different primate species can uncover epistatic relationships that explain variable penetrance of pigmentation disorders in humans.

MC1R research in non-human primates provides valuable context for understanding how genetic variations influence melanocyte function in different evolutionary and environmental contexts. This comparative approach complements human genetic studies and can suggest novel therapeutic targets or pathways for intervention in pigmentation disorders.

What techniques are most effective for analyzing potential interactions between Mueller's gibbon MC1R and other proteins involved in melanogenesis?

Several complementary techniques can effectively characterize protein-protein interactions involving Mueller's gibbon MC1R:

  • Co-immunoprecipitation (Co-IP): Using epitope-tagged versions of recombinant Mueller's gibbon MC1R expressed in melanocyte cell lines, researchers can immunoprecipitate the receptor and identify interacting partners through immunoblotting or mass spectrometry. This approach identifies stable interactions but may miss transient or weak associations.

  • Proximity labeling approaches: BioID or APEX2 fusion constructs with Mueller's gibbon MC1R allow biotinylation of proximal proteins in living cells, providing a snapshot of the receptor's interaction neighborhood regardless of interaction strength or stability.

  • FRET/BRET assays: For testing specific hypothesized interactions, fluorescence or bioluminescence resonance energy transfer between tagged MC1R and potential partners provides evidence of direct interaction within living cells, including quantitative measures of interaction dynamics.

  • Split-luciferase complementation: This approach can validate binary interactions and is amenable to high-throughput screening for novel interaction partners.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify interaction interfaces at amino acid resolution.

  • Yeast two-hybrid or mammalian two-hybrid assays: These methods can screen for novel interaction partners, though they may yield false positives and require validation with orthogonal methods.

For MC1R specifically, key interaction partners to investigate include:

  • Agouti signaling protein (ASIP) - the endogenous antagonist of MC1R

  • β-arrestins - involved in receptor desensitization and trafficking

  • Melanocortin receptor accessory proteins (MRAPs) - modulate receptor surface expression and signaling

  • Components of the melanogenic enzyme complex (TYR, TYRP1, DCT)

What are the most significant unanswered questions regarding Mueller's gibbon MC1R function that warrant further investigation?

Several critical knowledge gaps regarding Mueller's gibbon MC1R function deserve research attention:

  • Evolutionary role in primate pigmentation: Despite MC1R's well-established role in human pigmentation, evidence suggests it may not play a prominent role in pelage color variation in non-human primates, including Mueller's gibbon . Understanding this evolutionary divergence in MC1R function could reveal alternative genetic pathways controlling pigmentation in different primate lineages.

  • Ligand specificity differences: Whether Mueller's gibbon MC1R shows different binding affinities for melanocortin peptides (α-MSH, ACTH, β-MSH) compared to human MC1R remains uninvestigated. Such differences could explain species-specific pigmentation responses.

  • Non-melanogenic functions: In humans, MC1R has roles beyond pigmentation, including modulating inflammation, pain sensitivity, and DNA damage responses. Whether these functions are conserved in Mueller's gibbon MC1R is unknown but important for understanding receptor evolution.

  • Environmental adaptation: How Mueller's gibbon MC1R function may be adapted to the specific environmental conditions (UV exposure, temperature, etc.) of its native habitat represents an interesting eco-evolutionary question.

  • Regulation of expression: The transcriptional and post-transcriptional mechanisms controlling Mueller's gibbon MC1R expression in different cell types and developmental stages remain largely unexplored.

  • Pharmacological responses: How Mueller's gibbon MC1R responds to synthetic melanocortin analogs and antagonists compared to human MC1R could reveal structural insights valuable for drug development.

Addressing these questions will require interdisciplinary approaches combining molecular biology, comparative genomics, structural biology, and evolutionary analyses. The results would contribute not only to our understanding of primate pigmentation biology but also to broader questions about G protein-coupled receptor evolution and adaptation.

What are the key methodological considerations when designing experiments with recombinant Mueller's gibbon MC1R?

When designing experiments with recombinant Mueller's gibbon MC1R, researchers should consider several critical methodological factors:

By carefully considering these methodological issues, researchers can generate more reliable and physiologically relevant data about Mueller's gibbon MC1R function.

How might comparative analysis of primate MC1R variants, including Mueller's gibbon, inform our understanding of human MC1R-related conditions?

Comparative analysis of primate MC1R variants provides several valuable insights for understanding human MC1R-related conditions:

  • Functional constraint mapping: By identifying amino acid positions conserved across diverse primate species, researchers can distinguish between variants likely to be functionally disruptive versus benign polymorphisms. This evolutionary approach to variant interpretation complements traditional functional studies.

  • Novel functional domains: Comparing sequences across primates may reveal previously unrecognized functional motifs that could be targeted therapeutically in human disorders.

  • Mechanism diversification: If certain primate species utilize MC1R in ways distinct from humans (e.g., different downstream signaling pathways), this could suggest alternative therapeutic approaches for MC1R-related conditions.

  • Environmental adaptation insights: Understanding how MC1R function has adapted to different environmental conditions across primate evolution could inform personalized approaches to melanoma prevention and treatment based on genetic background.

  • Gene network evolution: Comparative analysis may reveal how the broader gene network regulating pigmentation has evolved, highlighting compensatory mechanisms that could be therapeutically exploited.

Research has identified specific human MC1R variants (including R142H, R151C, R160W, and D294H) associated with red hair, fair skin, and increased melanoma risk . Determining whether homologous positions in Mueller's gibbon MC1R serve similar functional roles could provide evolutionary context for these human variants and potentially reveal compensatory mechanisms that might be therapeutically relevant.

What technological advances would most significantly accelerate research on Mueller's gibbon MC1R and other non-human primate melanocortin receptors?

Several technological advances would substantially accelerate research on Mueller's gibbon MC1R and related receptors:

  • Improved CRISPR gene editing in non-human primate cells: Development of more efficient protocols for gene editing in primate cell lines would enable precise manipulation of endogenous MC1R in relevant cell types.

  • Cryo-EM structures of primate MC1Rs: While human MC1R structure has been resolved, comparative structural biology of primate MC1Rs would reveal subtle species-specific differences that influence function.

  • Primate-derived organoids: Development of skin organoid models derived from different primate species would provide more physiologically relevant systems for studying MC1R function in a tissue context.

  • Single-cell multiomics: Advances in single-cell technologies that can simultaneously measure genome, transcriptome, and proteome from the same cell would help unravel the complex regulatory networks controlling MC1R expression and function in different cell types.

  • In situ protein interaction mapping: Technologies for visualizing and quantifying protein-protein interactions in their native cellular context would advance our understanding of MC1R signaling complexes.

  • Computational approaches: Improved algorithms for predicting the functional consequences of sequence variations would facilitate more targeted experimental designs and interpretation of newly identified variants.

  • Non-invasive imaging of melanin: Development of improved methods for quantifying melanin content and distribution in living cells and tissues would enhance phenotypic characterization of MC1R variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.