Recombinant Hylobates syndactylus Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UQCRFS1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
79-274
Protein Length
Full Length of Mature Protein
Species
Symphalangus syndactylus (Siamang) (Hylobates syndactylus)
Target Names
Target Protein Sequence
SHTDVKVPDFSEYRRPEVLDSTKSSRESSEARKGFSYLVTAVTTVGVAYAAKNAVTQFVS SMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP QHDLDRVKRPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNL EVPTYEFTSDDMVIVG
Uniprot No.

Target Background

Function

Recombinant Hylobates syndactylus Cytochrome b-c1 complex subunit Rieske, mitochondrial (UQCRFS1) is a component of ubiquinol-cytochrome c oxidoreductase (complex III, CIII), a multisubunit transmembrane complex within the mitochondrial electron transport chain (ETC). This complex plays a crucial role in oxidative phosphorylation. The ETC comprises three multisubunit complexes (complexes II, III, and IV) that facilitate electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Complex III catalyzes electron transfer from ubiquinol to cytochrome c, coupling this redox reaction to proton translocation across the inner mitochondrial membrane via the Q cycle. This cycle involves the consumption of two protons from the matrix, the release of four protons into the intermembrane space, and the transfer of two electrons to cytochrome c. The Rieske protein, a catalytic core subunit of complex III, contains an iron-sulfur cluster essential for this process. UQCRFS1 undergoes proteolytic processing after integration into the complex III dimer, yielding a fragment (subunit 9) corresponding to its mitochondrial targeting sequence (MTS). This processing is vital for correct insertion into the complex III dimer. However, the persistence of UQCRFS1-derived fragments can hinder the processing and assembly of newly imported UQCRFS1, negatively impacting complex III structure and function.

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is UQCRFS1 and what role does it play in mitochondrial function?

UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1) is one of three core catalytic subunits of the cytochrome bc1 complex (complex III) in the mitochondrial respiratory chain . As the Rieske iron-sulfur protein component, it contains an iron-sulfur cluster essential for electron transfer between ubiquinol and cytochrome c1. This electron transfer process is fundamental to cellular respiration and ATP production through oxidative phosphorylation. The protein's flexibility and motion are crucial for its electron transfer function, and these properties have garnered significant research attention .

What is the molecular weight and structure of UQCRFS1 in Hylobates syndactylus?

Based on comparative studies, the UQCRFS1 protein has a calculated molecular weight of approximately 30 kDa, though the observed molecular weight in experimental conditions is typically around 25 kDa . This discrepancy may be attributed to post-translational modifications or processing. The protein contains a characteristic iron-sulfur cluster (Fe2S2) coordinated by histidine and cysteine residues that forms its catalytic core. While specific structural data for Hylobates syndactylus UQCRFS1 is limited, its function as part of the cytochrome bc1 complex suggests structural conservation with other mammalian orthologs.

How can I reliably detect and quantify UQCRFS1 in primate tissue samples?

Several validated methodological approaches exist for UQCRFS1 detection:

TechniqueRecommended ProtocolSpecies ReactivityNotes
Western Blot1:1000-1:8000 dilution of anti-UQCRFS1 antibodyHuman, mouse, rat25 kDa band expected
Immunoprecipitation0.5-4.0 μg antibody per 1.0-3.0 mg total proteinMouse heart tissue validatedVerify specificity with controls
Immunohistochemistry1:250-1:1000 dilutionHuman tissuesRecommended antigen retrieval with TE buffer pH 9.0

For primate-specific detection, antibodies targeting conserved epitopes show cross-reactivity across mammalian species. When working with Hylobates syndactylus samples, validation experiments comparing signal detection across related primate species is advisable to confirm specificity.

How can I express and purify recombinant Hylobates syndactylus UQCRFS1 for functional studies?

A methodological approach for recombinant expression includes:

  • Gene amplification: Design primers based on conserved regions between human and other primate UQCRFS1 sequences to amplify the coding region from Hylobates syndactylus cDNA.

  • Expression system selection: Due to the presence of an iron-sulfur cluster, eukaryotic expression systems (insect cells or yeast) typically yield better results than bacterial systems for functional protein.

  • Optimized purification protocol:

    • Include mitochondrial targeting sequence removal for improved expression

    • Utilize affinity tags (His6 or FLAG) for initial purification

    • Employ ion-exchange chromatography as a secondary purification step

    • Confirm iron-sulfur cluster incorporation using UV-visible spectroscopy (characteristic absorbance at ~460 nm)

  • Quality control: Verify protein identity by mass spectrometry and western blot, and assess purity by SDS-PAGE with Coomassie staining.

  • Functional validation: Measure electron transfer activity using spectrophotometric assays with artificial electron acceptors.

What are the optimal conditions for studying UQCRFS1 function in cellular models?

Based on published methodologies, the following conditions have proven effective:

  • Cell line selection: Either primate cell lines or established models like A2780 and OVCAR8 cells with verified UQCRFS1 expression .

  • Functional modulation approaches:

    • Gene knockdown using siRNA transfection (48-72 hours post-transfection typically shows maximal effect)

    • Overexpression with tagged constructs for localization studies

    • CRISPR/Cas9 genome editing for stable knockout models

  • Functional readouts:

    • Cell proliferation: CCK8 assay shows significant changes following UQCRFS1 knockdown

    • Cell cycle analysis: Flow cytometry reveals G1 phase arrest upon UQCRFS1 depletion

    • ROS production: DCFH-DA fluorescence increases with UQCRFS1 knockdown

    • DNA damage response: RT-PCR for ATM and ATR shows upregulation with UQCRFS1 depletion

  • Pathway analysis: Western blot analysis of AKT/mTOR pathway components provides insight into signaling effects .

How can I assess the interaction between UQCRFS1 and other components of the cytochrome bc1 complex?

Several complementary approaches can be employed:

  • Co-immunoprecipitation: Using antibodies against UQCRFS1 to pull down associated complex components (cytochrome b, cytochrome c1).

  • Blue native PAGE: For analyzing intact cytochrome bc1 complex assemblies and subcomplexes.

  • Crosslinking mass spectrometry: To identify interaction interfaces between UQCRFS1 and neighboring subunits.

  • FRET-based assays: Using fluorescently tagged components to measure protein-protein interactions in living cells.

  • Inhibitor studies: Testing compounds that specifically affect UQCRFS1 mobility within the complex, as categorized by their ability to mobilize, restrict, or fix ISP rotation .

  • Structural analysis: Cryo-EM or X-ray crystallography of the intact complex to determine precise positioning and interactions of UQCRFS1.

How does Hylobates syndactylus UQCRFS1 compare to that of other primates in terms of sequence and function?

While specific comparative data for UQCRFS1 across primates is limited in the provided sources, evolutionary relationships among Hylobatidae can inform our understanding. Hylobates syndactylus (siamang) represents a sister taxon to great apes and humans within the primate superfamily Hominoidea . Cytogenetic comparisons indicate that H. syndactylus shares more chromosomal homology with H. concolor than with H. agilis, suggesting closer evolutionary relationships that may extend to gene conservation patterns .

The conservation of UQCRFS1 function is likely high due to its essential role in cellular metabolism. Antibodies raised against human UQCRFS1 show reactivity with mouse and rat samples , suggesting conservation of key epitopes across mammalian species. Given that Hylobates syndactylus is more closely related to humans than rodents, significant functional conservation would be expected.

What insights can be gained from studying Hylobates syndactylus UQCRFS1 in the context of primate evolution?

Studying UQCRFS1 in Hylobates syndactylus can provide valuable evolutionary insights:

  • Mitochondrial adaptation: Differences in UQCRFS1 sequence or regulation might reflect metabolic adaptations specific to hylobatid lifestyle and ecology.

  • Molecular phylogeny: Comparison of UQCRFS1 sequences across primates could contribute to resolving phylogenetic relationships within Hylobatidae, which show complex evolutionary patterns .

  • Selection pressure analysis: Examining the ratio of synonymous to non-synonymous mutations can reveal whether UQCRFS1 has undergone positive selection during primate evolution.

  • Function-structure relationships: Mapping sequence variations onto protein structure can identify conserved functional domains versus variable regions that may confer species-specific properties.

The cytogenetic data showing that H. syndactylus and H. concolor share several derived cytogenetic traits not present in H. agilis suggests complex evolutionary relationships that may be further elucidated through molecular studies of functionally important genes like UQCRFS1.

How does UQCRFS1 function affect cellular metabolism and energy production?

UQCRFS1 functions as a critical component of the mitochondrial respiratory chain with multifaceted effects on cellular metabolism:

  • Electron transport: As part of cytochrome bc1 complex, UQCRFS1 facilitates electron transfer from ubiquinol to cytochrome c, a key step in oxidative phosphorylation .

  • Energy production: Experimental data shows that UQCRFS1 knockdown significantly reduces cell proliferation, indicating its essential role in generating ATP needed for cellular growth .

  • Cell cycle regulation: UQCRFS1 depletion induces G1 phase cell cycle arrest and decreases expression of key cell cycle regulators including cyclin D1, CDK2, and CDK4 .

  • Oxidative stress balance: When UQCRFS1 is knocked down, ROS production increases significantly, demonstrating its role in maintaining redox homeostasis .

  • Apoptotic regulation: UQCRFS1 appears to have anti-apoptotic functions, as its knockdown increases the proportion of apoptotic cells .

These findings highlight UQCRFS1's central position at the intersection of energy metabolism, cell cycle control, and oxidative stress management.

What molecular mechanisms connect UQCRFS1 dysfunction to increased ROS production and DNA damage?

The relationship between UQCRFS1, ROS, and DNA damage involves several interconnected mechanisms:

  • Direct relationship: Experimental evidence shows that UQCRFS1 knockdown markedly enhances ROS production as measured by DCFH-DA fluorescence and flow cytometry .

  • Mechanistic pathway: The mitochondrial respiratory chain is the primary cellular site for ROS generation. UQCRFS1 dysfunction disrupts electron flow through complex III, potentially causing electron leakage and superoxide formation .

  • DNA damage connection: UQCRFS1 knockdown upregulates expression of DNA damage response genes ATM and ATR, while downregulating CHK1 and CHK2 . This pattern suggests activation of DNA damage sensing but impairment of checkpoint control.

  • Feedback loop: Excessive ROS can further damage mitochondrial components including UQCRFS1, potentially creating a vicious cycle of increasing dysfunction.

  • Signaling impact: UQCRFS1 knockdown inhibits the AKT/mTOR pathway , which may represent a cellular adaptive response to energy deficiency and oxidative stress.

These findings establish UQCRFS1 as a critical node in mitochondrial health, oxidative stress management, and genomic integrity maintenance.

How can UQCRFS1 be targeted for potential therapeutic applications?

Research on cytochrome bc1 complex inhibitors provides important insights for UQCRFS1-targeting approaches:

  • Strategic targeting based on protein dynamics: UQCRFS1 inhibitors can be classified by how they affect the Rieske protein's rotation - either mobilizing, restricting, or fixing ISP rotation . Each approach may have different therapeutic implications.

  • Structure-activity relationships: The strength of inhibitor interactions with the ISP correlates with inhibitor potency and development of resistance . This provides a foundation for rational drug design.

  • Potential cancer applications: High UQCRFS1 expression correlates with poor prognosis in epithelial ovarian cancer, suggesting it as a potential diagnostic or therapeutic target . Compounds that selectively inhibit UQCRFS1 in cancer cells could have therapeutic value.

  • Resistance management: Understanding the molecular mechanisms of resistance to UQCRFS1-targeting compounds can inform the development of novel inhibitors with lower resistance risk .

  • Delivery strategies: Since UQCRFS1 is localized to mitochondria, effective targeting requires delivery systems capable of reaching this subcellular compartment, such as mitochondria-targeted nanoparticles or peptides.

What are the technical challenges in developing high-throughput assays for UQCRFS1 activity?

Developing robust assays for UQCRFS1 faces several methodological challenges:

  • Context-dependent functionality: UQCRFS1 operates within the multiprotein cytochrome bc1 complex, making isolated activity assays potentially non-physiological.

  • Iron-sulfur cluster integrity: The Fe-S cluster is sensitive to oxidation and may degrade during sample preparation, affecting assay reliability.

  • Substrate accessibility: The natural substrate (ubiquinol) is highly hydrophobic, presenting challenges for aqueous assay systems.

  • Species-specific considerations: Assays developed for human UQCRFS1 may require optimization for Hylobates syndactylus protein due to sequence variations.

  • Activity differentiation: Distinguishing UQCRFS1-specific activity from that of other respiratory chain components requires selective inhibitors or genetic models.

Potential solutions include:

  • Using isolated mitochondria rather than purified protein

  • Employing artificial electron donors/acceptors with better aqueous solubility

  • Developing fluorescent or luminescent readouts compatible with high-throughput formats

  • Creating reconstituted minimal systems with defined components

What experimental approaches can reveal structure-function relationships in UQCRFS1?

To elucidate UQCRFS1 structure-function relationships, several complementary approaches can be employed:

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly those coordinating the Fe-S cluster or involved in protein-protein interactions.

  • Hydrogen-deuterium exchange mass spectrometry: To identify flexible regions and conformational changes associated with electron transfer.

  • Inhibitor binding studies: Comparing binding profiles of inhibitors that mobilize, restrict, or fix ISP rotation to understand dynamic functional states .

  • Cryo-EM analysis: Capturing different conformational states of the cytochrome bc1 complex to visualize UQCRFS1 movement during catalysis.

  • Molecular dynamics simulations: Computational modeling of UQCRFS1 motion within the complex under different conditions.

  • Domain swapping experiments: Creating chimeric proteins with domains from different species to identify regions responsible for species-specific properties.

  • Cross-linking coupled with mass spectrometry: To map interaction interfaces between UQCRFS1 and other complex components.

These approaches can reveal how UQCRFS1 structure facilitates its electron transfer function and how structural alterations affect cellular energy production.

How is UQCRFS1 dysregulation implicated in human diseases, and what does this suggest for primate models?

UQCRFS1 dysregulation has significant disease implications:

  • Cancer association: UQCRFS1 is highly expressed in epithelial ovarian cancer and correlates with poor prognosis . Functional studies demonstrate that UQCRFS1 knockdown reduces proliferation, induces G1 arrest, increases apoptosis, and inhibits the AKT/mTOR pathway, suggesting oncogenic properties .

  • Metabolic disorders: As a key component of oxidative phosphorylation, UQCRFS1 dysfunction may contribute to mitochondrial disorders characterized by energy deficiency.

  • Oxidative stress-related conditions: UQCRFS1 knockdown increases ROS production , potentially contributing to conditions where oxidative stress plays a pathogenic role.

  • DNA damage and genomic instability: UQCRFS1 depletion affects expression of DNA damage response genes , suggesting a link to genomic integrity maintenance.

These findings position UQCRFS1 at the intersection of cancer biology, energy metabolism, and cellular stress responses. Hylobates syndactylus could serve as a valuable model for understanding the evolutionary conservation of these pathways and for testing interventions targeting UQCRFS1-related pathologies.

What mechanisms explain the correlation between UQCRFS1 expression and cell cycle regulation?

Experimental data reveals several mechanisms connecting UQCRFS1 to cell cycle control:

  • Direct cell cycle impact: UQCRFS1 knockdown induces G1 phase arrest and decreases the proportion of S-phase cells .

  • Molecular mediators: UQCRFS1 depletion reduces expression of critical cell cycle regulatory proteins including cyclin D1, CDK2, and CDK4 , explaining the G1 arrest phenotype.

  • Signaling pathway regulation: UQCRFS1 knockdown inhibits the AKT/mTOR pathway , a major regulator of cell growth and proliferation.

  • Metabolic influence: As a mitochondrial protein involved in energy production, UQCRFS1 likely affects ATP availability needed for cell cycle progression.

  • Oxidative stress connection: UQCRFS1 depletion increases ROS , which can activate cell cycle checkpoints and induce arrest.

These findings establish UQCRFS1 as an important factor in cell cycle regulation, providing a mechanistic explanation for its potential role in cancer and other proliferative disorders.

What are the key knowledge gaps in our understanding of UQCRFS1 in Hylobates syndactylus?

Several critical knowledge gaps exist in our understanding of Hylobates syndactylus UQCRFS1:

  • Species-specific sequence and structure: Complete sequence data and structural characterization of siamang UQCRFS1 remain to be established.

  • Regulatory mechanisms: How UQCRFS1 expression and activity are regulated in different tissues and under various physiological conditions in siamangs is unknown.

  • Evolutionary adaptations: Whether siamang UQCRFS1 contains unique adaptations related to the species' ecological niche, metabolism, or longevity remains unexplored.

  • Functional conservation: The degree to which findings about UQCRFS1 function in model organisms translate to Hylobates syndactylus requires verification.

  • Tissue-specific expression: Patterns of UQCRFS1 expression across different siamang tissues and their correlation with metabolic activity need investigation.

  • Post-translational modifications: The specific PTMs affecting siamang UQCRFS1 function and their regulatory mechanisms remain to be characterized.

  • Interaction network: The complete set of proteins interacting with UQCRFS1 in siamang cells and how these compare to other primates is unknown.

How can advanced technologies be applied to study UQCRFS1 dynamics in living systems?

Several cutting-edge methodological approaches can advance UQCRFS1 research:

  • CRISPR-based tracking: CRISPR-based tagging of endogenous UQCRFS1 with fluorescent proteins for live-cell imaging with minimal disruption to function.

  • Super-resolution microscopy: Techniques like STED, PALM, or STORM to visualize UQCRFS1 localization and dynamics within mitochondrial substructures.

  • Optogenetic control: Light-activatable domains fused to UQCRFS1 to precisely manipulate its activity in space and time.

  • Single-molecule FRET: To measure conformational changes and interactions of individual UQCRFS1 molecules within the cytochrome bc1 complex.

  • Mitochondrial-targeted biosensors: Co-expression of sensors for ATP, ROS, or membrane potential to correlate UQCRFS1 function with mitochondrial physiology.

  • Intravital imaging: Visualizing UQCRFS1 dynamics in tissues of living organisms using appropriate animal models.

  • Mass spectrometry imaging: To map UQCRFS1 distribution and modifications across tissue sections with high spatial resolution.

  • Cryo-electron tomography: For visualizing UQCRFS1 in its native cellular environment at near-atomic resolution.

These advanced approaches would provide unprecedented insights into the dynamic behavior of UQCRFS1 in living systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.