Recombinant Hyperthermus butylicus UPF0290 protein Hbut_1639 (Hbut_1639)

What is Hyperthermus butylicus and why is its UPF0290 protein Hbut_1639 significant in research?

Hyperthermus butylicus is a hyperthermophilic neutrophile and anaerobe belonging to the archaeal kingdom Crenarchaeota. It was isolated from a solfataric habitat with temperatures reaching up to 112°C off the coast of São Miguel in the Azores. The organism is capable of growing between 80°C and 108°C with a broad temperature optimum .

The UPF0290 protein Hbut_1639 is significant because it comes from an extremophile capable of surviving in extraordinarily high temperatures. Such proteins often possess remarkable stability characteristics that make them valuable for understanding protein folding, structure-function relationships in extreme conditions, and potential biotechnological applications that require thermostable proteins. The "UPF" designation (Uncharacterized Protein Family) indicates that the specific function of this protein hasn't been fully determined, presenting an opportunity for novel research discoveries .

What are the structural characteristics of the Hbut_1639 protein?

The Hbut_1639 protein has the following structural characteristics:

• Amino acid sequence: MAQLLTPLESILAIIPALAANGAPVLLKYHGTPIDGGKRFLDGRPVLGPGKTWEGLATGILYGSVIALLAASATCNPKLYAAGVFASIGAMLGDMLGAFIKRRLGLERGAPAPLLDQLDFFSGALLALYAAGYVVHPAVALTFTPIVIALHRLTNMAANRLRLKPVPW

• Expression region: 1-168

• UniProt accession: A2BN92

The protein appears to contain hydrophobic regions typical of membrane-associated proteins, which aligns with the general characteristics of hyperthermophilic proteins that often display higher proportions of charged residues like glutamic acid, arginine, and lysine on their surfaces to maintain stability at extreme temperatures .

How is recombinant Hbut_1639 protein typically stored and handled in laboratory settings?

For optimal preservation of recombinant Hbut_1639 protein integrity:

• Storage temperature: -20°C for regular storage; -80°C recommended for extended storage periods

• Buffer composition: Typically maintained in Tris-based buffer with 50% glycerol optimized for protein stability

• Freeze-thaw cycles: Repeated freezing and thawing is not recommended; working aliquots should be prepared and stored at 4°C for up to one week

• Shipping conditions: Usually shipped with dry ice to maintain low temperature

What experimental designs are most effective when studying thermostable proteins like Hbut_1639?

When studying thermostable proteins like Hbut_1639, effective experimental designs should include these key elements:

Table 1: Experimental Design Components for Thermostable Protein Research

A robust experimental design requires significant planning to ensure control over the testing environment, sound experimental treatments, and proper assignment of subjects to treatment groups. Without proper planning, unexpected external variables can alter an experiment's outcome . For thermostable proteins specifically, temperature control precision becomes critical when establishing structure-function relationships.

When designing experiments for Hbut_1639 research, the quasi-experimental design may be appropriate when comparing to other UPF0290 family members from different organisms, as this allows researchers to conduct similar experiments by assigning subjects to groups based on non-random criteria .

What purification methods yield the highest activity for recombinant Hbut_1639?

While specific purification protocols optimized for Hbut_1639 are not directly provided in the search results, a methodological approach can be derived based on characteristics of hyperthermophilic proteins:

• Heat treatment: Exploit the thermostability advantage by incubating cell lysates at 70-80°C for 15-20 minutes to precipitate most E. coli host proteins while retaining folded Hbut_1639

• Affinity chromatography: If the recombinant protein contains a tag (the tag type for commercial recombinant Hbut_1639 is determined during the production process), the appropriate affinity resin should be used

• Size exclusion chromatography: As a polishing step to remove aggregates and ensure homogeneity

• Buffer optimization: Maintaining proper ionic strength is critical for hyperthermophilic proteins that typically have higher surface charge densities

• Activity verification: Following purification, activity assays should be performed at elevated temperatures (80-95°C) to confirm functionality in the protein's native temperature range

The purification strategy should take into account that hyperthermophile proteins generally contain a higher proportion of charged residues (glutamic acid, arginine, and lysine) and fewer non-charged polar residues like glutamine on their surfaces .

What are the recommended controls when conducting functional assays with Hbut_1639?

For functional assays with Hbut_1639, implement the following controls:

Negative controls:

• Heat-denatured Hbut_1639 (exposed to temperatures above stability threshold)

• Buffer-only samples without protein

• Related proteins outside the UPF0290 family

Positive controls:

• When possible, include other characterized UPF0290 family members

• If specific activity has been established, include samples with known activity levels

• Include internal standards for quantitative measurements

Procedural controls:

• Temperature stability controls (measurements at multiple timepoints at experimental temperature)

• pH stability controls (especially important given H. butylicus is a neutrophile)

• Cofactor dependency controls (with and without potential cofactors)

How might Hbut_1639's potential membrane association influence experimental approaches?

The amino acid sequence of Hbut_1639 suggests potential membrane association, with segments containing hydrophobic residues typical of membrane proteins or membrane-interacting domains . This characteristic necessitates specific experimental considerations:

• Solubilization strategies: When expressing and purifying Hbut_1639, researchers should consider:

  • Testing multiple detergents (mild non-ionic detergents like DDM or LDAO)

  • Employing lipid nanodiscs or amphipols for maintaining native-like membrane environments

  • Using detergent screening arrays to identify optimal solubilization conditions

• Structural studies adaptation:

  • Cryo-EM may be preferable to crystallography for membrane-associated proteins

  • NMR studies should employ membrane mimetics like bicelles or nanodiscs

  • Molecular dynamics simulations should include explicit membrane models

• Functional assays:

  • Include liposome reconstitution experiments to assess membrane interaction

  • Test function in the presence of archaeal lipid extracts that mimic H. butylicus membranes

  • Measure activity with and without membrane components to assess dependency

Given that H. butylicus is a hyperthermophile growing between 80-108°C , the membrane composition of this organism likely contains unique lipids that contribute to thermostability. Researchers should consider how these native lipid environments might affect Hbut_1639 function when designing experimental systems.

What computational approaches are most valuable for predicting Hbut_1639 function given its UPF0290 classification?

As an uncharacterized protein family member (UPF0290), computational approaches become essential for generating functional hypotheses about Hbut_1639. The most valuable computational strategies include:

Table 2: Computational Approaches for UPF0290 Protein Function Prediction

When applying these approaches, researchers should leverage H. butylicus genome data, which consists of a single circular chromosome of 1,667,163 bp with a 53.7% G+C content and 1,672 annotated genes . The genomic context can provide valuable clues about function, particularly since approximately one-third of H. butylicus genes are specific to this organism .

The integration of multiple computational predictions rather than reliance on any single method will provide the most robust hypotheses for experimental validation.

How should researchers address potential conflicts between predicted and experimental data for Hbut_1639?

When confronted with discrepancies between computational predictions and experimental results for Hbut_1639, researchers should implement this systematic resolution framework:

• Validation of experimental conditions:

  • Verify that experimental conditions (particularly temperature) reflect the native environment of H. butylicus (80-108°C)

  • Confirm protein integrity using multiple analytical methods (SDS-PAGE, mass spectrometry, circular dichroism)

  • Assess whether the recombinant expression system might introduce artifacts (post-translational modifications, folding issues)

• Reassessment of computational predictions:

  • Evaluate confidence scores associated with predictions

  • Consider whether the hyperthermophilic nature of the protein might affect prediction accuracy

  • Apply alternative computational methods and observe consensus patterns

• Hypothesis refinement:

  • Formulate testable hypotheses that might explain discrepancies

  • Design experiments specifically targeting the areas of disagreement

  • Consider whether partial functions or context-dependent activities might reconcile differences

• Consultation with specialized expertise:

  • Engage with researchers experienced in archaeal biology

  • Consult with structural biologists familiar with thermostable proteins

  • Seek input from computational biologists about model limitations

The high level of specialized genes in H. butylicus (up to a third are specific to this organism) suggests that novel or unique functions may not be accurately predicted by standard computational approaches calibrated on mesophilic model organisms.

How does the codon usage in Hbut_1639 influence recombinant expression strategies?

The H. butylicus genome demonstrates unusual codon usage patterns with a high level of GUG and UUG start codons compared to other crenarchaeal genomes . This characteristic has significant implications for recombinant expression strategies:

Table 3: Codon Optimization Strategies for Hbut_1639 Expression

When expressing Hbut_1639, researchers should consider:

• Start codon selection: The native Hbut_1639 may use alternative start codons; expression vectors should be designed accordingly

• Rare codon analysis: The G+C content of H. butylicus (53.7%) may result in codon preferences that are underrepresented in common expression hosts

• Expression temperature: Standard expression hosts (E. coli, yeast) operate at much lower temperatures than H. butylicus; consider temperature-inducible systems or psychrophilic expression hosts with post-induction temperature elevation

• Protein folding assessment: Compare structures of proteins expressed with different codon optimization strategies to ensure native folding

The codon usage patterns and high G+C content in hyperthermophiles like H. butylicus likely reflect adaptations to extreme environments , making careful codon optimization essential for successful heterologous expression.

What insights can comparative studies between Hbut_1639 and UPF0290 homologs from mesophilic organisms provide?

Comparative studies between Hbut_1639 and its mesophilic homologs can yield valuable insights into protein evolution, thermoadaptation mechanisms, and structure-function relationships. Key research approaches include:

• Comparative sequence analysis:

  • Identify conserved residues across temperature adaptations (likely functional)

  • Highlight thermophile-specific substitutions (likely stability-related)

  • Analyze charge distribution differences between thermophilic and mesophilic variants

• Thermal stability comparisons:

  • Measure denaturation temperatures (Tm) across homologs

  • Quantify activity retention after heat exposure

  • Assess refolding capacity following denaturation

• Structural dynamics investigation:

  • Compare flexibility at equivalent positions using hydrogen-deuterium exchange

  • Analyze temperature-dependent conformational changes

  • Measure dynamics parameters using NMR relaxation methods

• Functional conservation assessment:

  • Test substrate specificity across homologs

  • Measure kinetic parameters at various temperatures

  • Perform complementation studies in relevant model organisms

Such comparative approaches are particularly valuable considering that H. butylicus and other hyperthermophilic neutrophiles show distinctive adaptations compared to hyperthermophilic acidophiles, including higher G+C content in their genomes and specific amino acid compositions on protein surfaces .

How should researchers interpret Hbut_1639 function in the context of H. butylicus metabolism?

To interpret Hbut_1639 function within the broader metabolic context of H. butylicus, researchers should consider:

• Metabolic network integration:

  • H. butylicus utilizes peptide mixtures as carbon and energy sources

  • The organism can generate energy by reducing elemental sulfur to H₂S

  • Several peptidases with diverse specificities are encoded in the genome

  • Fermentation products include CO₂, 1-butanol, acetic acid, and phenylacetic acid

• Protein localization significance:

  • If membrane-associated, Hbut_1639 may participate in:

    • Transport of peptides or amino acids

    • Energy conservation processes

    • Sensing environmental conditions

    • Maintaining membrane integrity at extreme temperatures

• Comparative genomic context:

  • Evaluate whether Hbut_1639 homologs appear in other sulfur-reducing hyperthermophiles

  • Determine if genomic neighbors are conserved across related species

  • Assess whether the gene is part of any apparent operons

• Physiological conditions influence:

  • Test function under anaerobic conditions that mimic H. butylicus native environment

  • Examine activity in the presence of sulfur compounds

  • Evaluate temperature-dependent activity profiles aligned with growth temperature range (80-108°C)

H. butylicus is an anaerobe with genes for detoxification of O₂ (superoxide reductase and peroxyredoxin) , which suggests that any experiments with Hbut_1639 should consider the redox environment as a potentially important factor affecting function.

What are the most promising applications for Hbut_1639 in biotechnology research?

Based on its hyperthermophilic origin and unique characteristics, Hbut_1639 presents several promising biotechnological applications:

Table 4: Potential Biotechnological Applications of Hbut_1639

Though the specific function of Hbut_1639 remains uncharacterized (UPF0290 family) , its potential applications can be extrapolated from its source organism properties and protein characteristics. The unique adaptations of proteins from extreme environments often translate to valuable properties for biotechnological applications.

Researchers pursuing these applications should consider the distinctive metabolic capabilities of H. butylicus, including its ability to utilize peptide mixtures and reduce elemental sulfur , as these may provide clues to natural substrate preferences or cofactor requirements.

What methodological advances would most benefit Hbut_1639 functional characterization?

Several methodological advances would significantly accelerate functional characterization of Hbut_1639:

• High-temperature activity assay platforms:

  • Development of high-throughput screening methods functional at 80-108°C

  • Creation of thermostable reporter systems compatible with H. butylicus proteins

  • Adaptation of microfluidic systems for extreme temperature conditions

• Improved archaeal genetic systems:

  • CRISPR-based genetic manipulation tools for H. butylicus

  • Expression systems specifically designed for hyperthermophilic archaea

  • Thermostable selectable markers and reporters

• Advanced structural biology approaches:

  • Time-resolved structural techniques capturing conformational changes at high temperatures

  • In situ structural determination methods within membrane environments

  • Cryo-EM methodologies optimized for small archaeal proteins

• Metabolomic integration:

  • High-temperature metabolomics platforms to identify substrates/products

  • Stable isotope tracking systems functional at extreme temperatures

  • Computational metabolic flux analysis tools calibrated for archaeal metabolism

• Synthetic biology frameworks:

  • Minimal archaeal chassis optimized for heterologous expression

  • Cell-free systems derived from thermophilic components

  • High-temperature biosensor arrays for function detection

These methodological advances would help overcome the considerable technical challenges in working with proteins from extremophiles like H. butylicus, which naturally functions at temperatures (80-108°C) well beyond the range of most laboratory equipment and biological systems.

How might studying Hbut_1639 contribute to our understanding of protein evolution in extreme environments?

Studying Hbut_1639 can provide valuable insights into protein evolution under extreme conditions through several research perspectives:

• Molecular adaptation mechanisms:

  • Identifying specific amino acid substitutions that confer thermostability

  • Understanding structural features that maintain function at 80-108°C

  • Revealing potential trade-offs between stability and catalytic efficiency

• Evolutionary trajectory analysis:

  • Comparing UPF0290 family members across thermophilic and mesophilic lineages

  • Reconstructing ancestral sequences to track evolutionary paths

  • Identifying convergent evolution patterns in different thermophilic lineages

• Genomic context exploration:

  • Examining whether Hbut_1639 was horizontally transferred between thermophiles

  • Analyzing conservation patterns across archaeal phyla

  • Determining whether the gene underwent duplication or specialization events

• Fundamental protein biophysics:

  • Testing protein folding models under extreme conditions

  • Investigating how thermostability affects protein dynamics and flexibility

  • Exploring the limits of protein function in extreme environments

H. butylicus represents an interesting evolutionary case study as a hyperthermophilic neutrophile with distinctive genomic characteristics. Up to one-third of H. butylicus genes are specific to this organism , suggesting unique evolutionary paths. The high G+C content (53.7%) contrasts with the lower values found in hyperthermophilic acidophiles (32-37%), potentially reflecting different adaptive strategies to extreme environments .