Recombinant Hyphomonas neptunium ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Despite limited direct studies on H. neptunium atpB, methodologies for recombinant protein production in this species have been established:

  • Expression Systems: Copper- and zinc-inducible promoters enable tightly regulated expression of target genes in H. neptunium .

  • Tagging and Detection: Fluorescent protein fusions (e.g., Venus/YFP) facilitate localization studies .

Example Workflow for Recombinant atpB Production:

StepMethodApplication
CloningatpB coding sequence ligated into inducible vector (e.g., pCU-based plasmid)Ensures controlled expression
ExpressionInduction with Cu²⁺/Zn²⁺Optimizes protein yield
PurificationAffinity chromatography (His-tag)Isolates recombinant atpB

3.1. Homology and Sequence Analysis

While H. neptunium atpB has not been explicitly sequenced in the provided sources, comparative analysis with homologs (e.g., Streptomyces lividans) reveals:

  • Conserved Motifs: Transmembrane domains and proton-binding residues align with bacterial ATP synthase subunits .

  • Interaction with Subunit c: Critical for F₀ sector assembly .

3.2. Functional Studies in Related Species

  • Proton Channel Activity: In S. lividans, subunit a forms a helical bundle that interacts with subunit c to drive proton translocation .

  • Essentiality: Knockout of atpB in model bacteria leads to non-viable phenotypes, underscoring its role in energy metabolism .

Challenges and Future Directions

  • Knowledge Gaps: Direct structural or functional data on H. neptunium atpB remain sparse. Current insights are extrapolated from homologs .

  • Potential Applications: Engineering atpB variants could elucidate its role in H. neptunium’s unique budding cycle and stalk biogenesis .

Data Tables

Table 1: Comparative Features of ATP Synthase Subunits

SubunitGeneRoleH. neptunium Status
aatpBProton channel assemblyHypothetical, based on homologs
catpEProton translocationRecombinant forms characterized

Table 2: Recombinant Protein Expression Parameters

ParameterDetail
HostE. coli (common for subunit c )
InductionHeavy metals (Cu²⁺/Zn²⁺) for H. neptunium
Yield~90% purity achievable via affinity chromatography

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know and we will prioritize its development.
Synonyms
atpB; HNE_1919; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Hyphomonas neptunium (strain ATCC 15444)
Target Names
atpB
Target Protein Sequence
MPAIALDPIHQFEVTKWLDLRLGNIDISFTNASGFMLLGVVLVIGFFSMATRKGELVPSR LQSVAEMGYGFIADMVRSAAGEEGLKFFPFVFTLFFFILFANLIGMVPYAFTTTSHIIVT GALAMTVILMVIVVGLIKNGLGFFKLFAPSGAPLPIYIILTPIEIISFLARPLTLGLRLF ANMLAGHIMLKLFAGFTVMLIGAGAIYIPVAALAFAMGVALNALEFLVAGLQAYVFAILT CVYLNDALHADAH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpB) in Hyphomonas neptunium?

ATP synthase subunit a (atpB) is a critical component of the F-type ATP synthase complex V in H. neptunium. This membrane-embedded subunit forms part of the proton channel within the F₀ sector of the complex. Based on studies of ATP synthase in other organisms, the subunit a in H. neptunium likely plays essential roles in:

  • Forming the proton translocation pathway through the membrane

  • Providing structural stability to the ATP synthase complex

  • Facilitating the interaction between the stationary parts of the complex and the rotating c-ring

  • Contributing to the assembly and organization of ATP synthase dimers and oligomers

While the H. neptunium ATP synthase has not been specifically characterized in the provided sources, research on mitochondrial ATP synthase indicates that subunit a (24.8 kDa) is typically added at later stages of complex assembly and is crucial for the stabilization of the holocomplex .

How does H. neptunium's unique cell cycle affect ATP synthase distribution and function?

H. neptunium exhibits a distinctive two-step chromosome segregation process during its budding life cycle, which differs from typical binary fission in most bacteria . This unique cell biology raises important questions about energy metabolism and ATP synthase distribution:

  • Initial phase: The mother cell contains ATP synthase complexes that likely support energy requirements during stalk formation

  • Budding phase: As the bud forms at the stalk tip, ATP synthase components must be distributed to the nascent bud compartment

  • Final separation: Energy requirements likely increase during the final separation of mother and daughter cells

The stalked morphology creates unique bioenergetic challenges, including how energy-generating components like ATP synthase are transported through the narrow stalk to support bud formation and growth. This process may involve:

  • De novo synthesis of ATP synthase components in the bud

  • Transport of pre-assembled subcomplexes through the stalk

  • Specialized regulatory mechanisms to coordinate energy production with budding

The temporal separation of chromosomal replication and segregation in H. neptunium suggests that energetic demands may be similarly temporally regulated during the unique cell cycle.

What genetic tools are available for studying atpB in H. neptunium?

Based on research methodologies used for studying other aspects of H. neptunium biology, several genetic approaches can be applied to study atpB:

  • Fluorescent protein fusions: Similar to the ParB-YFP fusion techniques used to study chromosome segregation in H. neptunium , atpB can be tagged with fluorescent markers to track its localization throughout the cell cycle

  • Conditional expression systems: A zinc-inducible promoter system has been successfully used in H. neptunium for studying ParA-Venus fusions , which could be adapted for atpB studies

  • Deletion mutants: While complete deletion of essential genes like atpB may not be viable, conditional mutants could be generated using approaches similar to those described for studying chromosome segregation factors

Genetic ApproachApplication to atpB StudyTechnical Considerations
Fluorescent taggingVisualization of atpB localizationC-terminal vs. N-terminal fusion validity must be determined
Conditional expressionControlled depletion studiesRequires careful titration of inducer concentrations
Complementation analysisTesting functionality of modified variantsWild-type behavior must be restored under normal conditions
Transposon mutagenesisIdentifying interacting partnersTransposon system established but still being optimized for H. neptunium

What expression systems are optimal for producing recombinant H. neptunium atpB?

Production of membrane proteins like ATP synthase subunit a presents significant challenges that require specialized methodologies:

Bacterial Expression Systems:

  • E. coli C41(DE3) or C43(DE3) strains: These "Walker strains" are specifically designed for membrane protein expression and may provide better yields of functional atpB

  • Controlled expression rate: Using weaker promoters or lower induction temperatures (16-20°C) can improve proper membrane integration

  • Fusion tags approach: N-terminal fusions with MBP or SUMO can improve solubility while C-terminal His-tags facilitate purification

Cell-Free Expression Systems:

  • For highly toxic membrane proteins like atpB, cell-free systems supplemented with lipids or detergents can provide an alternative approach

  • The addition of nanodiscs or liposomes to cell-free reactions can support proper folding of atpB

Optimization Protocol:

  • Clone atpB gene with and without its predicted signal sequence

  • Test multiple expression strains in parallel (standard BL21, C41/C43, Lemo21)

  • Evaluate expression at varied temperatures (16°C, 25°C, 30°C, 37°C)

  • Optimize induction conditions (IPTG concentration from 0.1-1.0 mM)

  • Screen detergents for extraction (starting with mild detergents like DDM, LMNG, or C12E8)

How should researchers approach the purification of recombinant H. neptunium atpB?

Purification of atpB requires specific considerations due to its membrane-embedded nature:

Membrane Isolation and Solubilization:

  • Cell lysis by pressure disruption (French press or microfluidizer)

  • Differential centrifugation to isolate membrane fraction (40,000-100,000 × g)

  • Membrane solubilization using detergent screening

    • Begin with mild detergents (DDM, LMNG)

    • Optimize detergent:protein ratio (typically 10:1 to 5:1)

    • Incubate with gentle rotation (4°C for 1-2 hours)

Purification Strategy:

  • Initial capture: Immobilized metal affinity chromatography (IMAC)

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography with appropriate detergent in mobile phase

Quality Control Assessment:

  • SDS-PAGE and Western blotting to confirm identity and purity

  • Circular dichroism to assess secondary structure integrity

  • Mass spectrometry to confirm protein identity and detect post-translational modifications

Based on ATP synthase assembly studies, researchers should be aware that subunit a typically interacts closely with subunit A6L (in mitochondria) or equivalent bacterial subunits , which may affect purification behavior.

What functional assays can be used to characterize recombinant H. neptunium atpB?

Proton Transport Assays:

  • Reconstitution into proteoliposomes with appropriate lipid composition

  • pH-sensitive fluorescent dye-based assays (ACMA or pyranine)

  • Measurement of proton transport upon addition of ATP or generation of membrane potential

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation with other ATP synthase subunits

  • Surface plasmon resonance to measure binding kinetics

  • Crosslinking followed by mass spectrometry to identify interaction interfaces

Structural Analysis:

  • Cryo-electron microscopy of reconstituted complexes

  • Limited proteolysis to identify exposed regions

  • Hydrogen-deuterium exchange mass spectrometry to analyze conformational dynamics

Assembly Assays:
Based on findings from mitochondrial ATP synthase studies, researchers can analyze the role of atpB in complex assembly:

  • Blue native PAGE to visualize complex formation with and without atpB

  • Sucrose gradient centrifugation to separate assembled complexes from subunits

  • Pulse-chase labeling to track the kinetics of complex assembly

How might the unique dimorphic life cycle of H. neptunium affect ATP synthase assembly and function?

H. neptunium's distinctive life cycle involves budding from a stalk-like structure, with chromosome segregation occurring in a two-step process . This unique cellular organization likely imposes special requirements on energy metabolism:

Spatiotemporal Regulation Hypotheses:

  • ATP synthase assembly may be regulated in coordination with cell cycle progression

  • Different subpopulations of ATP synthase complexes may exist in the mother cell versus the bud

  • The narrow stalk may require specialized mechanisms for ATP synthase transport or localized ATP generation

Experimental Approaches:

  • Time-lapse microscopy with fluorescently tagged atpB to track localization during the cell cycle

    • Similar to the ParB-YFP tracking approaches used for chromosome segregation studies

  • Immunogold electron microscopy to visualize ATP synthase distribution with nanometer resolution

  • Cell cycle synchronization followed by quantitative proteomics to measure ATP synthase subunit abundance at different stages

Comparative Analysis:
Researchers could compare H. neptunium ATP synthase with related alphaproteobacteria (particularly Caulobacter crescentus) to identify adaptations specific to the budding lifestyle. This type of analysis revealed that H. neptunium's chromosome segregation process is uniquely adapted to its life cycle , suggesting energy metabolism might similarly show specialized adaptations.

What role might atpB play in H. neptunium's adaptation to marine environments?

As a marine bacterium, H. neptunium faces specific environmental challenges that may influence ATP synthase function:

Environmental Adaptations:

  • Salt tolerance: ATP synthase might have adaptations for function in saline conditions

  • pH fluctuations: Marine environments can experience pH changes that affect proton motive force

  • Temperature variations: Enzyme stability and optimal temperature ranges may reflect habitat

Research Approaches:

  • Comparative sequence analysis of atpB across marine versus non-marine bacteria

  • Functional analysis under varied salt concentrations, pH values, and temperatures

  • Analysis of ATP synthesis rates under simulated environmental stress conditions

Methodological Considerations:
When measuring ATP synthase activity in recombinant systems, researchers should consider:

  • Buffer composition that mimics marine conditions (appropriate salt concentrations)

  • Temperature ranges relevant to H. neptunium's natural habitat

  • Testing substrate affinities under varying ionic conditions

What are common challenges in obtaining functional recombinant H. neptunium atpB?

Expression Challenges:

  • Toxicity: Overexpression of membrane proteins often inhibits bacterial host growth

  • Inclusion body formation: Improper folding leads to aggregation and loss of function

  • Proteolytic degradation: Partially folded intermediates may be targeted by proteases

Solutions and Workarounds:

  • Use tightly controlled expression systems with lower induction levels

  • Screen multiple fusion tags to improve solubility

  • Include protease inhibitors during all purification steps

  • Consider co-expression with ATP synthase assembly factors or chaperones

How can researchers validate the structural integrity of purified recombinant atpB?

Structural Validation Methods:

  • Circular dichroism spectroscopy to confirm alpha-helical content expected for membrane proteins

  • Thermal shift assays to assess protein stability in different detergent environments

  • Limited proteolysis patterns to confirm proper folding

  • Native mass spectrometry to analyze oligomeric state and interactions

Activity-Based Validation:

  • Reconstitution into liposomes and measurement of proton translocation

  • Binding assays with known interaction partners from the ATP synthase complex

  • Complementation studies in ATP synthase-deficient systems

What approaches can address the challenge of studying interactions between atpB and other ATP synthase components?

Based on ATP synthase assembly studies, it's known that subunit a (atpB) interacts with multiple components and is added at later stages of complex assembly . Studying these interactions requires specialized approaches:

In vitro Interaction Studies:

  • Pulldown assays using purified components with different affinity tags

  • Reconstitution of minimal subunit complexes to study pairwise interactions

  • Surface plasmon resonance or isothermal titration calorimetry to measure binding affinities

In vivo Interaction Approaches:

  • Bacterial two-hybrid systems adapted for membrane protein interactions

  • FRET-based measurements between fluorescently labeled subunits

  • In vivo crosslinking followed by mass spectrometry

Structural Biology Approaches:

  • Cryo-electron microscopy of reconstituted ATP synthase complexes

  • Solid-state NMR of specifically labeled components

  • X-ray crystallography of stabilized subcomplexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.