Recombinant Hyphomonas neptunium Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; HNE_0190; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Hyphomonas neptunium (strain ATCC 15444)
Target Names
mscL
Target Protein Sequence
MFKEFKEFALKGNLVDLAVGFILGGAFGTIVTSLVNDIMMPPLGMLMGGVDFADLFISLN GTEYVSLVAATEAGAPVIAYGKFINAVISFVIMALALFFVIKGMNTLKKKEEAAPPPAPP RQEVLLEEIRNLLAKNQ
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Hyphomonas neptunium and why is it relevant as a research model?

Hyphomonas neptunium is a marine alphaproteobacterium that reproduces through a unique budding mechanism where daughter cells emerge from the end of a stalk-like extension emanating from the mother cell body . Originally isolated from seawater near Barcelona, Spain, H. neptunium was first classified as Hyphomicrobium neptunium before reclassification .

This bacterium has gained scientific significance because:

  • It exhibits a distinctive mode of reproduction different from binary fission seen in most bacteria

  • It demonstrates a unique two-step chromosome segregation process reminiscent of eukaryotic mitosis

  • It serves as an excellent model system for studying polar growth, budding, cell aging, and chromosome transport

  • Genomic analysis indicates a close phylogenetic relationship with Caulobacter crescentus despite differences in reproductive mechanisms

H. neptunium has been established as a model organism at research facilities like the Max Planck Institute for Terrestrial Microbiology, where scientists study its mechanisms of budding, chromosome segregation, and cell division .

How is recombinant H. neptunium mscL typically produced for research purposes?

Recombinant H. neptunium mscL protein is typically produced using heterologous expression systems, with E. coli being the most common host organism . The general production methodology involves:

  • Cloning the mscL gene (HNE_0190) into a suitable expression vector with a histidine tag or other affinity tag for purification

  • Transforming the recombinant plasmid into an E. coli expression strain

  • Inducing protein expression under controlled conditions

  • Cell lysis and protein purification using affinity chromatography

  • Quality control assessment including SDS-PAGE analysis for purity (typically ≥85-90%)

  • Final preparation as either a lyophilized powder or in a stabilized buffer solution

Storage recommendations include:

  • Storage at -20°C to -80°C for long-term preservation

  • Addition of 5-50% glycerol as a cryoprotectant (typically 50% is standard)

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

For reconstitution, the lyophilized protein is typically dissolved in a Tris/PBS-based buffer to a concentration of 0.1-1.0 mg/mL .

How can I establish a genetic system for studying mscL function in H. neptunium?

Establishing a genetic system for studying mscL function in H. neptunium requires specialized techniques due to the distinctive characteristics of this bacterium. Based on the molecular toolbox developed by Jung et al. (2015), the following methodology is recommended:

Transformation Protocol:

  • Conjugation is the preferred method for transferring plasmids into H. neptunium using E. coli strain WM3064 (dap mutant) as a donor

  • Harvest early-stationary-phase cultures of H. neptunium (2 ml) and E. coli WM3064 carrying your plasmid of interest (1 ml) by centrifugation

  • Wash each pellet with 1 ml MB medium and resuspend in 100 μl medium containing 300 μM DAP

  • Mix suspensions and spot onto an MB-agar plate containing 300 μM DAP (without antibiotics)

  • Incubate overnight at 28°C, then scrape off cells and wash twice in MB medium (without DAP)

  • Plate dilutions on selective MB-agar plates and incubate for 5 days at 28°C

Selection Markers:
Kanamycin (100/200 μg/ml in liquid/solid medium) or rifampin (1/2 μg/ml) are effective for H. neptunium

Gene Expression Systems:
Two heavy metal-inducible promoters (PCu and PZn) have been identified in H. neptunium with:

  • Low basal activity

  • High dynamic range

  • Specific activation by copper and zinc

  • Optimal induction at 0.5 mM CuSO₄ or 0.5 mM ZnCl₂

Vector Design Considerations:
For studying mscL function, integrative plasmids similar to pEC1, pEC41, pSE10, or pSE46 can be modified to include the mscL gene. These plasmids enable:

  • Stable integration into the H. neptunium genome

  • Regulated expression via heavy metal-inducible promoters

  • Creation of fluorescent protein fusions for localization studies

What are the optimal growth conditions for H. neptunium when conducting mscL expression studies?

Optimal growth conditions for H. neptunium when conducting mscL expression studies are critical for ensuring physiologically relevant results:

Standard Growth Conditions:

  • Medium: Difco Marine Broth 2216 (MB)

  • Temperature: 28°C

  • Aeration: Vigorous shaking (210 rpm) in baffled flasks

  • Expected growth characteristics: Generation time of approximately 3 hours under optimal conditions

Cell Culture Monitoring:

  • Cell density measurement: OD₆₀₀ spectrophotometric readings

  • Growth phase considerations: Early-stationary phase cultures are generally used for experiments

  • Typical cell density for experiments: Dilution to OD₆₀₀ of 0.05-0.5 depending on experiment type

Induction Parameters for mscL Expression Studies:
For controlled expression of mscL using the heavy metal-inducible promoters:

ParameterCopper InductionZinc InductionNotes
InducerCuSO₄ZnCl₂ or ZnSO₄Stock solutions: 20 mM CuSO₄, 1 M ZnCl₂/ZnSO₄
Optimal concentration0.5 mM0.5 mMHigher concentrations may be toxic
Induction timingMid-log phase (OD₆₀₀ ≈ 0.5)Mid-log phase (OD₆₀₀ ≈ 0.5)For most consistent expression
Sampling timepointst₀, t₂₀, t₆₀t₀, t₂₀, t₆₀Minutes after induction
Expression window20-60 minutes post-induction20-60 minutes post-inductionPeak expression typically observed

Toxicity Considerations:
It's important to note that metal concentrations should be carefully controlled, as higher concentrations can be toxic to H. neptunium. Growth inhibition studies have shown dose-dependent effects of copper and zinc on cellular viability .

What are the key challenges in purifying functional recombinant mscL from H. neptunium?

Purifying functional recombinant mscL from H. neptunium presents several challenges that researchers should anticipate:

Membrane Protein Solubilization:
As a membrane channel protein, mscL requires special considerations for solubilization and maintaining its native conformation. Key challenges include:

  • Selection of appropriate detergents that effectively solubilize the protein without denaturing it

  • Maintaining the protein's native conformation during extraction from the membrane

  • Preventing protein aggregation during purification steps

Expression System Considerations:
While E. coli is commonly used as an expression host, researchers should be aware of:

  • Potential differences in membrane composition between E. coli and H. neptunium that may affect protein folding

  • Codon usage bias that might necessitate codon optimization for efficient expression

  • The need for specialized E. coli strains designed for membrane protein expression

Functional Assessment:
Verifying that the purified recombinant mscL retains its mechanosensitive properties requires:

  • Reconstitution into liposomes or lipid bilayers for functional assays

  • Patch-clamp electrophysiology to measure channel conductance in response to membrane tension

  • Osmotic shock assays to assess channel function in protecting cells from lysis

Stability Issues:
Maintaining stability of the purified protein presents challenges including:

  • Limited shelf-life due to the tendency of membrane proteins to aggregate

  • Sensitivity to freeze-thaw cycles, requiring careful aliquoting and storage protocols

  • Need for optimized buffer conditions with appropriate stabilizing agents (typically 50% glycerol is used)

How does the structure and function of H. neptunium mscL compare to mechanosensitive channels in other bacterial species?

The structure and function of H. neptunium mscL show both conservation and species-specific adaptations compared to other bacterial mechanosensitive channels:

Structural Comparison:
Based on sequence analysis and structural predictions, H. neptunium mscL contains the characteristic features of bacterial mechanosensitive channels:

  • Two transmembrane domains connected by a periplasmic loop

  • Cytoplasmic N- and C-terminal domains

  • Pentameric assembly forming a central pore

When compared to the well-characterized MscL from E. coli and M. tuberculosis:

FeatureH. neptunium MscLE. coli MscLM. tuberculosis MscL
Protein length137 aa136 aa151 aa
Transmembrane domains222
N-terminal domainShortShortShort
C-terminal domainLong with charged residuesLong with charged residuesExtended with additional helical segment
Key conserved residuesF22, V23, I27, G30, G43F19, V23, I24, G30, G43F29, V33, I37, G40, G53

Functional Adaptation:
The mechanosensitive function of H. neptunium mscL likely reflects adaptation to its marine environment:

  • Marine bacteria experience frequent osmotic challenges due to salinity fluctuations

  • H. neptunium's budding reproduction through a stalk may create unique membrane tension dynamics

  • The channel likely responds to hypoosmotic shock by allowing rapid efflux of cytoplasmic solutes

Key gating properties likely include:

  • High tension threshold for opening (typical of MscL channels)

  • Large conductance when open (estimated at >1 nS based on homology)

  • Non-selective pore permitting passage of both ions and small solutes

Evolutionary Context:
Phylogenetic analysis suggests that the mscL gene in H. neptunium was likely acquired through vertical inheritance rather than horizontal gene transfer, as it shows expected sequence divergence consistent with its evolutionary distance from other proteobacteria .

How might the mscL channel contribute to the unique budding reproduction cycle of H. neptunium?

The mscL channel may play specialized roles in the unique budding reproduction cycle of H. neptunium, though this remains an area requiring further investigation:

Potential Roles During the Budding Cycle:

  • Stalk Formation and Extension:

    • During stalk formation, localized membrane remodeling and cytoskeletal rearrangements create mechanical stress

    • The mscL channel might function as a mechanosensor during this process, potentially coordinating cellular responses to membrane deformation

    • Localized calcium influx through mechanosensitive channels could regulate cytoskeletal dynamics during stalk extension

  • Bud Emergence and Growth:

    • The emergence of the bud at the stalk tip creates significant membrane curvature and tension

    • MscL could act as part of a feedback mechanism sensing membrane tension during bud growth

    • Channel activity might influence turgor pressure and osmolyte distribution between mother cell and developing bud

  • Cell Division and Separation:

    • During the final separation of mother and daughter cells, significant membrane remodeling occurs

    • MscL could protect against transient osmotic imbalances during cytokinesis

    • The channel might participate in signaling pathways coordinating chromosome segregation with cell division

Hypothesized Cellular Distribution:
Based on the cell biology of H. neptunium, mscL distribution might be spatially regulated:

  • Enrichment at the growing bud site would support a role in bud formation

  • Localization at the stalk-bud junction could support a role in cell division

  • Uniform distribution would suggest a general protective function against osmotic stress

Regulatory Integration:
The mscL channel likely functions within the broader regulatory networks controlling the H. neptunium cell cycle:

  • Potential coordination with the ParABS chromosome segregation system during the two-step segregation process

  • Integration with cell cycle regulators homologous to those in C. crescentus

  • Possible connections to regulatory pathways controlling stalk formation and bud emergence

What methodological approaches can be used to study the electrophysiological properties of recombinant H. neptunium mscL?

Studying the electrophysiological properties of recombinant H. neptunium mscL requires specialized techniques adapted for mechanosensitive channel research:

Patch-Clamp Electrophysiology:
The gold standard for direct measurement of mechanosensitive channel activity:

  • Preparation Methods:

    • Reconstitution into giant unilamellar vesicles (GUVs) or giant E. coli spheroplasts

    • Formation of planar lipid bilayers containing purified mscL

    • Expression in mammalian cells lacking endogenous mechanosensitive channels

  • Recording Configurations:

    • Inside-out patch: Apply negative pressure to the patch pipette to induce membrane tension

    • Outside-out patch: Apply positive pressure to stretch the membrane

    • Whole-cell configuration: Limited utility due to global membrane stress

  • Key Parameters to Measure:

    • Pressure threshold for channel opening (typically in mmHg)

    • Single-channel conductance (expected to be >1 nS based on other MscL channels)

    • Channel kinetics (open probability, dwell times, subconductance states)

    • Ion selectivity (typically non-selective with slight cation preference)

Fluorescence-Based Approaches:
Less direct but higher-throughput methods:

  • FRET-Based Tension Sensors:

    • Engineering fluorescent protein pairs into key mscL domains to report conformational changes

    • Measuring FRET efficiency changes in response to osmotic downshock or membrane-active compounds

  • Fluorescent Dye Release Assays:

    • Encapsulating self-quenching fluorescent dyes in liposomes containing reconstituted mscL

    • Measuring fluorescence increase upon dye release through open channels in response to osmotic downshock

Structural Studies:
Complementary approaches to understand structure-function relationships:

  • Cryo-Electron Microscopy:

    • Determining the structure of H. neptunium mscL in different conformational states

    • Comparing with known structures from E. coli and M. tuberculosis MscL

  • Molecular Dynamics Simulations:

    • Modeling the gating mechanism in response to membrane tension

    • Predicting structural differences that might account for functional adaptations to the marine environment

Biological Functional Assays:
Measuring physiological channel function:

  • Osmotic Downshock Protection:

    • Expressing H. neptunium mscL in E. coli MscL-knockout strains

    • Assessing survival rates following hypoosmotic shock

    • Comparing protection efficacy with other bacterial MscL homologs

  • In vivo Fluorescence Imaging:

    • Creating fluorescent protein fusions to study subcellular localization during the H. neptunium cell cycle

    • Correlating localization patterns with stages of the budding process

What are common challenges in expressing H. neptunium proteins in heterologous systems and how can they be addressed?

Researchers working with H. neptunium proteins often encounter several challenges when using heterologous expression systems:

Codon Usage Bias:
H. neptunium has a GC content of approximately 62%, which differs from common expression hosts:

OrganismGC Content
H. neptunium~62%
E. coli~51%
S. cerevisiae~38%

Solution approaches:

  • Codon optimization of the target gene for the expression host

  • Use of specialized E. coli strains supplemented with rare tRNAs (e.g., Rosetta strains)

  • For severe codon bias, synthetic gene synthesis with optimized codons

Protein Folding and Solubility:
Membrane proteins like mscL are particularly challenging:

Solution approaches:

  • Expression at lower temperatures (16-20°C) to slow protein synthesis and improve folding

  • Use of specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Fusion with solubility-enhancing tags (MBP, SUMO, or thioredoxin)

  • Addition of mild detergents during cell lysis and purification

  • Exploring alternative expression systems (insect cells, cell-free systems)

Post-Translational Modifications:
While bacteria have fewer PTMs than eukaryotes, differences between H. neptunium and expression hosts may be significant:

Solution approaches:

  • Characterize native PTMs in H. neptunium proteins when possible

  • Consider homologous expression systems if PTMs are critical

  • For phosphorylation-dependent functions, co-express with appropriate kinases

Toxicity Issues:
Expression of membrane channels can disrupt host cell membranes:

Solution approaches:

  • Use tightly regulated inducible promoters (araBAD, T7lac)

  • Titrate inducer concentrations to minimize toxicity

  • Consider targeting the protein to inclusion bodies with subsequent refolding

  • Use strains with enhanced membrane protein expression capacity

Verification Approaches:
To ensure proper expression and function:

  • Western blotting with antibodies against the protein or affinity tag

  • Mass spectrometry to verify protein identity and integrity

  • Functional assays specific to mechanosensitive channels (osmotic shock protection, patch-clamp)

  • Circular dichroism to assess secondary structure content

How can discrepancies in mscL functional data between in vitro and in vivo experiments be reconciled?

Researchers often encounter discrepancies between in vitro and in vivo functional data when studying mechanosensitive channels like mscL. Understanding and reconciling these differences is crucial for accurate interpretation:

Common Discrepancies and Reconciliation Strategies:

  • Pressure Sensitivity Thresholds:

    Typical discrepancy: Purified mscL in artificial membranes often requires higher membrane tension to open compared to native channels.

    Reconciliation approaches:

    • Account for membrane composition differences (lipid composition affects channel sensitivity)

    • Consider membrane asymmetry in native membranes versus symmetric artificial bilayers

    • Evaluate the impact of membrane-cytoskeleton interactions present in vivo but absent in vitro

    • Measure lateral membrane tension directly rather than applied pressure when possible

  • Channel Kinetics:

    Typical discrepancy: Opening and closing rates may differ significantly between in vitro and in vivo settings.

    Reconciliation approaches:

    • Assess temperature effects (many in vitro experiments are conducted at room temperature)

    • Consider the influence of membrane fluidity on channel kinetics

    • Evaluate the impact of cellular crowding on channel conformational changes

    • Examine potential interactions with other membrane proteins present in vivo

  • Conductance and Ion Selectivity:

    Typical discrepancy: Single-channel conductance and ion selectivity measurements may vary between systems.

    Reconciliation approaches:

    • Standardize ionic conditions between in vitro and in vivo experiments

    • Account for differences in membrane potential

    • Consider the influence of cellular factors that might modulate channel properties

    • Evaluate effects of different recording techniques (patch-clamp vs. fluorescence-based methods)

  • Physiological Function:

    Typical discrepancy: Osmotic protection assays in heterologous systems may not precisely reflect the channel's native function in H. neptunium.

    Reconciliation approaches:

    • Consider the unique physiological context of H. neptunium (marine environment, budding reproduction)

    • Examine differences in osmotic stress response between host and native organisms

    • Develop assays specifically designed to test hypothesized functions in the budding cycle

    • Incorporate physiologically relevant stressors beyond simple osmotic shock

Integrated Experimental Design for Reconciliation:
A comprehensive approach that integrates multiple techniques can help resolve discrepancies:

  • Comparative Approaches:

    • Parallel testing of H. neptunium mscL alongside well-characterized homologs (E. coli MscL)

    • Systematic variation of experimental conditions to identify key factors causing discrepancies

    • Cross-validation using multiple independent techniques

  • Reconstitution Complexity Gradient:

    • Start with minimal systems (purified protein in defined lipids)

    • Progressively add complexity (native lipid extracts, cytoskeletal elements)

    • Compare with cellular systems of increasing similarity to the native environment

  • Mutagenesis Strategy:

    • Create parallel mutations for testing in both in vitro and in vivo systems

    • Focus on residues predicted to affect specific functional properties

    • Use structure-function correlations to interpret discrepancies

What are the implications of H. neptunium's unique chromosome segregation mechanism for understanding mscL function in cellular adaptation?

The unique two-step chromosome segregation mechanism in H. neptunium provides an intriguing context for investigating mscL function beyond its canonical role in osmotic protection:

Potential Functional Connections:

  • Physical Constraints During DNA Translocation:

    The process of moving a chromosome through the narrow stalk structure creates unique physical and mechanical challenges:

    • The stalk diameter (typically 100-200 nm) constrains chromosome compaction

    • Translocation creates mechanical stress on membranes potentially activating mechanosensitive channels

    • MscL activation could modulate local osmotic pressure facilitating DNA movement

  • Temporal Coordination with Cell Cycle:

    H. neptunium's chromosome segregation occurs in two distinct steps that align with specific cell cycle stages:

    • Initial segregation within mother cell (similar to other bacteria)

    • Subsequent rapid translocation through stalk into developing bud

    MscL expression or activity might be temporally regulated to coordinate with these stages:

    • Potential role in sensing completion of first segregation step

    • Involvement in signaling pathways that trigger the second segregation step

    • Coordination with divisome assembly at the stalk-bud junction

  • Spatial Organization Considerations:

    The subcellular localization of mscL channels could reveal functional specialization:

    • Enrichment at the stalk base might support a role in facilitating chromosome entry

    • Localization along the stalk could indicate involvement in DNA translocation

    • Presence at the stalk-bud junction might suggest a role in chromosome capture in the bud

Experimental Approaches to Explore These Connections:

  • Correlative Microscopy:

    • Fluorescently tag both mscL and chromosome markers (ParB-YFP)

    • Perform time-lapse imaging to correlate mscL localization with chromosome movement

    • Use super-resolution microscopy to visualize fine details of stalk architecture and protein distribution

  • Functional Perturbation:

    • Create conditional depletion strains of mscL using the established copper/zinc-inducible system

    • Analyze effects on chromosome segregation timing and efficiency

    • Examine potential synthetic phenotypes with mutations in segregation machinery (ParA, ParB)

  • Mechanosensitive Properties During Cell Cycle:

    • Develop techniques to measure membrane tension in different cellular compartments

    • Correlate tension changes with chromosome movement events

    • Assess mscL activity using fluorescent reporters during chromosome segregation

Broader Implications for Bacterial Cell Biology:

Understanding the potential role of mscL in H. neptunium's unique chromosome segregation has implications for:

  • Evolutionary Perspective:

    • Insight into how mechanosensitive functions may have been co-opted for specialized cellular processes

    • Understanding of how budding bacteria solved the challenge of moving large macromolecular complexes through narrow cellular extensions

    • Perspective on the relationship between physical forces and genetic information transfer

  • Comparative Cell Biology:

    • Parallels with other systems involving DNA movement through constrained spaces

    • Connections to mechanisms in other stalked bacteria with different reproductive strategies

    • Potential analogies to nuclear envelope dynamics in eukaryotic cells

How might understanding H. neptunium mscL contribute to the development of bacterial cell engineering and synthetic biology applications?

The unique properties of H. neptunium mscL offer promising avenues for bacterial cell engineering and synthetic biology applications:

Potential Applications in Synthetic Biology:

  • Engineered Mechanosensing Cellular Systems:

    • Development of bacterial biosensors that respond to mechanical stimuli

    • Creation of synthetic circuits linking mechanical stress to gene expression

    • Engineering bacteria with enhanced tolerance to osmotic fluctuations in industrial bioprocesses

  • Exploitation of Budding Mechanisms:

    • Adaptation of H. neptunium's budding mechanism for controlled release of cellular products

    • Engineering asymmetric cell division for segregation of specific cellular components

    • Development of systems for targeted delivery of molecules through stalk-like extensions

  • Chromosome Segregation Tools:

    • Application of the two-step segregation mechanism for controlled DNA distribution

    • Development of synthetic chromosomal organization systems based on ParABS

    • Creation of artificial cellular compartmentalization with directed DNA transport

Research Priorities for Enabling These Applications:

  • Structure-Function Characterization:

    • Determine high-resolution structure of H. neptunium mscL in different conformational states

    • Map the tension-sensing residues that trigger channel opening

    • Identify domains that might mediate interaction with other cellular components

  • Regulatory Network Integration:

    • Elucidate how mscL expression is regulated during the H. neptunium cell cycle

    • Identify potential signaling pathways involving mscL activation

    • Map interactions between mechanosensing and other cellular processes

  • Protein Engineering Approaches:

    • Develop mscL variants with altered gating properties

    • Create chimeric channels combining domains from different bacterial species

    • Engineer tension-sensitive domains that can be incorporated into other proteins

Methodological Innovations Needed:

  • Advanced Imaging Techniques:

    • Development of fluorescent tension reporters compatible with bacterial systems

    • Adaptation of super-resolution microscopy for studying stalk and bud structures

    • Creation of microfluidic systems to apply controlled mechanical stimuli during imaging

  • Genetic Tools Expansion:

    • Extension of the current genetic toolbox with additional inducible promoters

    • Development of CRISPR-Cas9 systems optimized for H. neptunium

    • Creation of high-throughput screening methods for mechanosensitive phenotypes

  • Computational Modeling:

    • Simulation of membrane dynamics during budding and stalk formation

    • Prediction of chromosome movement through constrained spaces

    • Modeling of mechanosensitive channel gating in complex membrane geometries

What insights could comparative studies between H. neptunium and other dimorphic prosthecate bacteria provide about mechanosensing adaptation?

Comparative studies between H. neptunium and other dimorphic prosthecate bacteria (DPB) offer valuable insights into mechanosensing adaptation across different ecological niches and reproductive strategies:

Key Comparative Systems:

OrganismEnvironmentReproduction ModeStalk Function
H. neptuniumMarineBudding from stalk tipReproductive structure
C. crescentusFreshwaterDivision with stalk formationAdhesion structure
Hyphomicrobium spp.Soil/FreshwaterBudding from hyphal tipReproductive structure
Rhodomicrobium spp.FreshwaterBudding from vegetative cellsConnection between cells

Evolutionary Adaptations of Mechanosensitive Systems:

  • Environmental Adaptation:

    • Compare mscL properties between marine (H. neptunium) and freshwater (C. crescentus) species

    • Examine tension thresholds in relation to typical osmotic challenges in different habitats

    • Investigate channel conductance and selectivity adaptations to different ionic environments

  • Reproductive Strategy Correlations:

    • Compare mechanosensing proteins between budding bacteria (H. neptunium, Hyphomicrobium) and binary fission bacteria (most other bacteria)

    • Examine potential specialization of channels at reproductive structures

    • Investigate coordination between mechanosensing and chromosome segregation across different reproductive modes

  • Structural Variations:

    • Compare amino acid sequences and predicted structures of mscL across DPB species

    • Identify conserved versus variable regions that might reflect specific functional adaptations

    • Examine membrane composition differences and their impact on mechanosensitive channel function

Research Questions for Comparative Studies:

  • Mechanosensing and Cell Polarity:

    • How do mechanosensitive channels contribute to the establishment of cell polarity in different DPB?

    • Is there differential distribution of channels at distinct cellular poles?

    • Do mechanical forces play different roles in stalk formation versus bud formation?

  • Evolutionary Origins:

    • Did mechanosensitive functions evolve primarily for osmotic protection or for specialized cellular processes?

    • How ancient is the connection between mechanosensing and asymmetric reproduction?

    • What genetic changes facilitated adaptation of mechanosensitive systems to different environmental niches?

  • Signal Integration:

    • How do mechanosensing pathways integrate with other cellular signaling systems across different DPB?

    • Are there consistent patterns in how mechanical signals influence cell cycle progression?

    • Do similar mechanosensitive channel properties serve different functions in different cellular contexts?

Methodology for Comparative Approaches:

  • Genomic and Phylogenetic Analysis:

    • Comprehensive identification of mechanosensitive channel homologs across DPB

    • Reconstruction of evolutionary history of channel acquisition and divergence

    • Correlation of sequence changes with habitat transitions or reproductive strategy shifts

  • Heterologous Expression Studies:

    • Express mscL from different DPB in standardized systems (E. coli knockouts)

    • Compare functional properties under identical experimental conditions

    • Perform domain swapping between channels from different species to identify functional determinants

  • In Situ Characterization:

    • Develop parallel genetic tools for multiple DPB species

    • Create equivalent fluorescent protein fusions across species

    • Perform comparative live cell imaging under controlled environmental conditions

What technological advances are needed to fully characterize the role of mechanosensitive channels in specialized bacterial reproductive processes?

To fully characterize the role of mechanosensitive channels in specialized bacterial reproductive processes like H. neptunium's budding mechanism, several technological advances are needed:

Advanced Imaging Technologies:

  • High-Resolution 4D Imaging:

    • Development of super-resolution microscopy techniques compatible with long-term live-cell imaging

    • Creation of minimal photodamage approaches for tracking entire cell cycles

    • Integration of multiple fluorescent markers to simultaneously track chromosome movement, protein localization, and membrane dynamics

  • Tension Mapping Technologies:

    • Development of fluorescent tension-sensitive probes that can be genetically encoded in bacteria

    • Creation of methods to measure membrane tension with subcellular resolution

    • Techniques to visualize nanoscale membrane deformations during budding and stalk formation

  • Correlative Microscopy Approaches:

    • Integration of fluorescence microscopy with electron cryotomography

    • Development of microfluidic platforms for rapid sample preparation and imaging

    • Methods for in situ structural determination of protein complexes in their native context

Genetic and Molecular Tools:

  • Expanded Genetic Manipulation Capabilities:

    • Development of CRISPR-Cas9 genome editing optimized for H. neptunium and other DPB

    • Creation of additional inducible promoter systems with different dynamic ranges and induction kinetics

    • Methods for controlled protein degradation to achieve rapid depletion of target proteins

  • Single-Cell Biochemistry:

    • Technologies for measuring protein-protein interactions in single bacterial cells

    • Methods for assessing channel activation at specific subcellular locations

    • Approaches for local perturbation of membrane properties in defined cellular regions

  • Synthetic Biology Approaches:

    • Designer cellular systems to test mechanosensitive channel function in minimal contexts

    • Reconstitution of budding processes in heterologous systems

    • Development of artificial cellular protrusions for studying constrained DNA movement

Computational and Data Analysis Advances:

  • Multiscale Modeling:

    • Integration of molecular dynamics simulations with cellular-scale mechanical models

    • Predictive modeling of chromosome movement through constrained spaces

    • Simulation of membrane dynamics during complex morphological changes

  • Machine Learning Applications:

    • Automated analysis of complex cellular morphologies and dynamics

    • Pattern recognition for identifying subtle phenotypic changes

    • Integration of multimodal datasets (genomic, structural, imaging) to build comprehensive models

  • Quantitative Analysis Frameworks:

    • Standardized methods for measuring and comparing cellular mechanical properties

    • Statistical approaches for analyzing stochastic cellular processes

    • Tools for quantifying spatial and temporal correlations between multiple cellular components

Integration of Physical and Biological Approaches:

  • Microfluidic Technologies:

    • Devices capable of applying controlled mechanical stimuli to bacterial cells

    • Systems for rapid environmental change with simultaneous imaging

    • Platforms for long-term tracking of individual cells through complete life cycles

  • Force Measurement and Manipulation:

    • Adaptation of atomic force microscopy for bacterial systems

    • Development of optical tweezers approaches for manipulating bacterial subcellular structures

    • Methods for local application of tension to specific regions of bacterial membranes

  • Artificial Cell Systems:

    • Creation of simplified membrane systems that recapitulate key aspects of bacterial membranes

    • Development of cell-sized compartments with controlled geometry

    • Integration of cytoskeletal elements and DNA in artificial systems to study mechanical influences on DNA movement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.