Recombinant Hyphomonas neptunium Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion during production.
Synonyms
htpX; HNE_3367; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Hyphomonas neptunium (strain ATCC 15444)
Target Names
htpX
Target Protein Sequence
MGTAKTFTLLAAMTAIFMAIGFLVGGMAGMILAFVVAAGMNVFAWWNSDKMVLRMQGAQE VLPDTKNPMLRAFGEDVARLAENAGLPAPRIYIIDTPQPNAFATGRNPQNAAVAATTGLL NMLNREEVAGVMAHELAHVQNRDTLTMTVTATLAGAIGMLANFALFFGRDRAGLIGSIAI MIFAPMAAALVQMAISRSREYVADKRGAEICGNPLWLASALEKIERGARSQINPYAERSP AMAHMYISNPLNGRGQDKLFSTHPSTANRVEALRRMAGEMGISGVAAPTARSSGPWG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Hyphomonas neptunium and why is it significant for research?

Hyphomonas neptunium is a marine dimorphic prosthecate bacterium (DPB) that reproduces through a unique budding mechanism. Unlike most bacteria that reproduce through binary fission, H. neptunium utilizes its stalk as a reproductive structure, with daughter cells emerging from the end of this stalk-like extension emanating from the mother cell body. This organism belongs to the Alphaproteobacteria class, Rhodobacterales order, and Hyphomonadaceae family . H. neptunium is particularly significant as a simple model of development due to its asymmetric reproduction, offering insights into polar growth and developmental processes in bacteria. The species has been fully sequenced and is of interest for studying fundamental biological processes that differ from conventional bacterial systems .

What genomic features characterize the htpX gene in Hyphomonas neptunium?

The htpX gene in Hyphomonas neptunium is part of the organism's single chromosome (accession number NC_008358). Based on genomic analyses, the gene encodes a membrane-bound metalloprotease that shares conserved domains with other bacterial HtpX homologs. The gene contains recognition sites for restriction endonucleases such as BamHI and SmaI, which are useful for molecular cloning strategies . Comparative genomic analyses have shown that H. neptunium shares more genes with Caulobacter crescentus (another dimorphic prosthecate bacterium) than with Silicibacter pomeroyi (a closer relative according to 16S rRNA phylogeny), suggesting evolutionary conservation of genes related to their unique developmental processes .

How can researchers effectively transform Hyphomonas neptunium with recombinant plasmids?

Transformation of H. neptunium can be achieved through conjugation using Escherichia coli strain WM3064 (a diaminopimelic acid [DAP] auxotroph) as a donor. The protocol involves:

  • Harvest early-stationary-phase cultures of H. neptunium (2 ml) and E. coli WM3064 carrying the plasmid of interest (1 ml) by centrifugation.

  • Wash each pellet with 1 ml Marine Broth (MB) medium.

  • Resuspend both pellets in 100 μl medium containing 300 μM DAP and mix the suspensions.

  • Spot the mixture onto an MB-agar plate containing 300 μM DAP (without antibiotics).

  • Incubate overnight at 28°C.

  • Scrape off the cells from the plate and wash twice in MB medium without DAP.

  • Resuspend in 1 ml MB medium and plate dilutions on selective MB-agar plates.

  • Incubate for 5 days at 28°C to obtain transformants.

  • Verify plasmid insertion by colony PCR .

This method has been successfully used to transform H. neptunium with integrative plasmids such as pEC1, pEC41, pSE10, and pSE46, with proper insertion verified at specific genomic loci (e.g., HNE_1486 or HNE_2372) .

What are the recommended primer design strategies for amplifying the htpX gene?

Based on successful amplification approaches, the following primer design strategies are recommended for amplifying the htpX gene from H. neptunium:

  • Include appropriate restriction enzyme recognition sites at the 5' ends of primers (e.g., BamHI and SmaI) to facilitate subsequent cloning.

  • Design primers that specifically flank the htpX coding sequence, such as:

    • Forward primer: 5'-CGGATCCTGCTGCTAAAACATTCACTGTT-3' (including BamHI site)

    • Reverse primer: 5'-TCCCCGGGTTTATAGGAATGCAAGCGC-3' (including SmaI site)

  • Ensure primers have appropriate melting temperatures (typically 55-65°C) and minimal secondary structure formation.

  • Verify primer specificity against the H. neptunium genome to avoid non-specific amplification.

  • Consider codon optimization when designing primers for expression in heterologous systems.

Using this approach, the htpX gene can be successfully amplified by PCR using H. neptunium genomic DNA as a template, followed by recovery of the amplification product for subsequent cloning procedures .

What expression systems are suitable for producing recombinant HtpX protein?

Several expression systems have proven effective for producing recombinant HtpX protein:

Expression HostVectorInduction SystemAdvantagesLimitations
E. coli BL21(DE3)pHT43IPTG (1 mM)High transformation efficiency, rapid growth, well-established protocolsPotential improper folding of membrane proteins
Bacillus subtilis WB800NpHT43IPTG (1 mM)Efficient secretion, reduced proteolytic degradationMore complex transformation procedure
H. neptuniumIntegrative plasmids (pEC1, pSE10)Heavy metal induction (Cu2+, Zn2+)Native environment, proper folding, post-translational modificationsSlower growth, lower protein yields

For heterologous expression, the recombinant plasmid (e.g., pHT43-htpX) can be transformed into E. coli DH5α for verification, then into E. coli BL21(DE3) to improve transformation efficiency, and finally electro-transformed into B. subtilis WB800N using chloramphenicol resistance for selection. Expression can be induced with IPTG (final concentration 1 mM) when cultures reach OD600 ≈ 0.6–0.8 .

For expression in H. neptunium, the use of copper and zinc-inducible promoters incorporated into integrative plasmids has shown low basal activity and a high dynamic range, making them ideal for controlled expression of recombinant proteins .

How can researchers predict and analyze the tertiary structure of HtpX protease?

The tertiary structure of HtpX protease can be predicted and analyzed using a combination of computational tools and experimental validation:

  • Conserved domain analysis using the InterPro server (http://www.ebi.ac.uk/interpro/) to identify functional domains and motifs within the HtpX sequence.

  • Tertiary structure prediction using AlphaFold3, which provides highly accurate protein structure predictions based on deep learning approaches.

  • Analysis of binding pockets, particularly the D3 pocket that may interact with metal ions, using CASTpFold (http://sts.bioe.uic.edu/castp/index.html).

  • Visualization of the predicted tertiary structure using PyMOL to display structural features and potential active sites .

These computational approaches should be complemented with experimental validation through techniques such as circular dichroism spectroscopy to assess secondary structure content, limited proteolysis to identify domain boundaries, or X-ray crystallography/NMR for high-resolution structural determination if feasible.

What metal ions are associated with HtpX activity and how can metal binding be analyzed?

HtpX belongs to the family of metalloproteases, which typically require metal ions for their catalytic activity. While specific data for H. neptunium HtpX is limited in the provided search results, general approaches for analyzing metal binding include:

  • Bioinformatic prediction: Analysis of the HtpX sequence for conserved metal-binding motifs, particularly the characteristic HEXXH motif common in zinc-dependent metalloproteases.

  • D3 pocket analysis: Computational tools like CASTpFold can be used to identify potential metal-binding pockets within the protein structure. The D3 pocket is often associated with metal ion binding in proteases .

  • Experimental verification:

    • Atomic absorption spectroscopy to quantify bound metal ions

    • Activity assays in the presence of various metal ions (Zn2+, Fe2+, Ca2+, Mg2+) to determine metal preferences

    • Chelator studies using EDTA or 1,10-phenanthroline to assess metal dependence

    • Site-directed mutagenesis of predicted metal-binding residues

  • Structural analysis: Advanced techniques such as X-ray absorption spectroscopy (XAS) can provide detailed information on the coordination environment of metal ions within the protein.

How does the inducible expression system using heavy metals work in H. neptunium?

The heavy metal-inducible expression system in H. neptunium utilizes two promoters that are specifically activated by copper and zinc. Based on microarray analyses of H. neptunium, these promoters have been identified to have low basal activity in the absence of heavy metals and a high dynamic range upon induction, making them excellent tools for controlled gene expression .

The system functions through the following mechanism:

  • In the absence of heavy metals, the promoters exhibit minimal transcriptional activity, maintaining low basal expression of the target gene.

  • Upon addition of copper or zinc to the growth medium, these metals interact with specific metal-sensing transcriptional regulators in H. neptunium.

  • The metal-bound regulators undergo conformational changes that enable them to bind to specific sequences within the promoter regions.

  • This binding activates transcription, leading to expression of the gene of interest placed downstream of the inducible promoter.

These promoters have been incorporated into integrative plasmids featuring different selection markers and fluorescent protein genes, allowing for the construction of fluorescent protein fusions and their inducible expression in H. neptunium .

How can fluorescent protein fusions with HtpX be constructed and analyzed?

Construction and analysis of fluorescent protein fusions with HtpX can be achieved through the following steps:

  • Construction strategy:

    • Utilize integrative plasmids containing heavy metal-inducible promoters and various fluorescent protein genes available for H. neptunium .

    • Design fusion constructs with the fluorescent protein (e.g., GFP, mCherry) either at the N-terminus or C-terminus of HtpX, considering the membrane topology of HtpX.

    • For membrane proteins like HtpX, C-terminal fusions are often preferable to avoid disrupting signal sequences or transmembrane domains.

  • Transformation and expression:

    • Transform the fusion constructs into H. neptunium using the conjugation method described earlier.

    • Induce expression using appropriate concentrations of copper or zinc.

    • Optimize induction conditions by testing different metal concentrations and exposure times.

  • Analysis techniques:

    • Fluorescence microscopy to visualize subcellular localization of HtpX

    • Time-lapse imaging to track dynamic changes in localization during cell growth and division

    • Quantitative analysis of fluorescence intensity using image analysis software

    • Co-localization studies with other fluorescently labeled cellular components

    • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

  • Controls and validation:

    • Include constructs with fluorescent protein alone to account for non-specific localization

    • Confirm that the fusion protein retains HtpX functionality through complementation studies

    • Verify expression levels by Western blotting with antibodies against either HtpX or the fluorescent protein

What approaches can be used to analyze the enzymatic properties of recombinant HtpX?

Comprehensive analysis of the enzymatic properties of recombinant HtpX can be performed using the following approaches:

  • Substrate specificity determination:

    • Test activity against synthetic peptide substrates with different sequences

    • Utilize protein substrates known to be processed by other bacterial HtpX homologs

    • Develop fluorogenic or chromogenic substrates for continuous monitoring of activity

  • Kinetic parameter determination:

    • Measure initial reaction velocities at varying substrate concentrations

    • Calculate Km, Vmax, and kcat values using Michaelis-Menten kinetics

    • Analyze data using appropriate software (e.g., Origin 2021) with results reported as mean values ± standard deviation from triplicate experiments

  • Optimal conditions assessment:

    • Determine pH optimum by assaying activity across a range of pH values

    • Identify temperature optimum, considering that H. neptunium has an optimal growth temperature of 37°C

    • Assess ionic strength effects and cofactor requirements

  • Inhibition studies:

    • Test sensitivity to general protease inhibitors (e.g., PMSF, E-64, pepstatin A)

    • Evaluate inhibition by specific metalloprotease inhibitors

    • Determine inhibition constants (Ki) for effective inhibitors

  • Activity modulation:

    • Analyze the effects of various metal ions on activity

    • Investigate the impact of redox conditions on enzyme function

    • Assess activity changes under stress conditions relevant to H. neptunium's natural habitat

How can researchers investigate the role of HtpX in H. neptunium's unique cell cycle?

Investigating the role of HtpX in H. neptunium's unique cell cycle requires a multifaceted approach combining genetic, cell biological, and biochemical techniques:

  • Gene deletion and complementation:

    • Generate an htpX deletion mutant in H. neptunium using the established genetic system

    • Complement the mutation with wild-type htpX under its native or inducible promoter

    • Create point mutations in catalytic residues to distinguish between structural and enzymatic roles

  • Phenotypic characterization:

    • Analyze growth curves under standard and stress conditions

    • Examine cell morphology using phase-contrast and electron microscopy

    • Assess stalk formation and budding processes in the absence of functional HtpX

    • Measure cell cycle progression using synchronized cultures

  • Localization studies:

    • Use fluorescent protein fusions to track HtpX localization throughout the cell cycle

    • Perform immunogold electron microscopy for high-resolution localization

    • Investigate dynamic changes in localization during stalk formation and budding

  • Protein interaction analysis:

    • Identify HtpX interaction partners using co-immunoprecipitation

    • Perform bacterial two-hybrid screens to discover potential substrates

    • Validate interactions using bimolecular fluorescence complementation

  • Expression profiling:

    • Monitor htpX expression throughout the cell cycle using RNA-Seq or microarray analysis

    • Compare expression patterns with other cell cycle-regulated genes

    • Analyze protein levels using Western blotting with specific antibodies

This comprehensive approach would provide insights into whether HtpX plays a direct role in H. neptunium's unique reproductive mechanism or contributes indirectly through general protein quality control functions .

What are common challenges in expressing recombinant HtpX and how can they be addressed?

Researchers working with recombinant HtpX may encounter several challenges during expression and purification. The following table summarizes common issues and their solutions:

ChallengePotential CausesSolutions
Low expression levelsPromoter leakiness, codon bias, protein toxicityOptimize induction conditions, use tight promoter control, adapt codons to expression host, use lower growth temperature
Protein insolubilityMembrane protein nature, improper foldingExpress as fusion with solubility tags (MBP, SUMO), use mild detergents for extraction, optimize buffer conditions
Proteolytic degradationHost proteases, protein instabilityUse protease-deficient hosts (e.g., B. subtilis WB800N), add protease inhibitors, reduce expression temperature
Loss of activityImproper folding, missing cofactorsEnsure proper metal ion availability, optimize purification conditions to maintain native structure
Difficulty in transformationLow competence, plasmid instabilityOptimize transformation protocol, adjust antibiotic concentrations, use fresh competent cells

Additionally, when working specifically with H. neptunium:

  • Ensure proper growth conditions (aerobic, 28-37°C, Marine Broth medium)

  • Allow sufficient incubation time (5 days) after transformation

  • Consider using the optimized conjugation protocol with E. coli WM3064 as a donor

  • Verify proper insertion of plasmids by colony PCR before proceeding with expression studies

How can researchers optimize the induction conditions for maximum HtpX expression?

Optimizing induction conditions for maximum HtpX expression requires systematic testing of various parameters:

  • Inducer concentration:

    • For IPTG-based systems, test concentrations ranging from 0.1 mM to 1 mM

    • For heavy metal-inducible systems in H. neptunium, test various concentrations of copper or zinc

    • Perform dose-response experiments to identify the optimal inducer concentration that maximizes expression without toxicity

  • Induction timing:

    • Test induction at different growth phases (early, mid, late logarithmic phase)

    • The optimal point for IPTG induction is typically when cultures reach OD600 ≈ 0.6–0.8

    • Consider the growth kinetics of your specific expression host

  • Temperature optimization:

    • Lower temperatures (16-25°C) often improve folding of complex proteins

    • Compare expression at standard growth temperature versus reduced temperature after induction

    • Consider the native growth temperature range of H. neptunium (mesophilic, optimal at 37°C)

  • Media composition:

    • Test different growth media (LB, TB, MB for marine bacteria)

    • Consider supplementation with cofactors that might enhance HtpX folding or stability

    • For H. neptunium expression, ensure proper marine salts content in the medium

  • Induction duration:

    • Compare short (2-4 hours) versus long (overnight) induction periods

    • Monitor protein accumulation over time to determine optimal harvest point

    • Consider potential degradation with extended induction times

Each optimization parameter should be tested independently while keeping other variables constant, followed by combinatorial optimization of the most critical factors.

What statistical methods are appropriate for analyzing HtpX activity data?

When analyzing HtpX activity data, several statistical methods can be employed depending on the experimental design and the nature of the data:

  • Descriptive statistics:

    • Calculate mean, median, standard deviation, and standard error for replicate measurements

    • Present results as mean value ± standard deviation from triplicate experiments

    • Use box plots or violin plots to visualize data distribution

  • Comparative analyses:

    • For comparing two conditions (e.g., with/without metal cofactor):

      • Student's t-test (parametric) if data is normally distributed

      • Mann-Whitney U test (non-parametric) if normality cannot be assumed

    • For multiple conditions (e.g., different metal ions, pH values):

      • One-way ANOVA followed by post-hoc tests (Tukey's HSD, Bonferroni)

      • Kruskal-Wallis test (non-parametric alternative to ANOVA)

  • Regression analyses for enzyme kinetics:

    • Non-linear regression for fitting Michaelis-Menten kinetics

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for alternative visualizations

    • Use of specialized enzyme kinetics software or general statistical packages (Origin 2021)

  • Time-series analyses:

    • Repeated measures ANOVA for tracking activity changes over time

    • Growth curve modeling for correlating enzyme activity with bacterial growth phases

  • Data visualization:

    • Generate line graphs using Origin 2021 or similar software

    • Use consistent error bar representation (standard deviation or standard error)

    • Include appropriate statistical significance indicators (*, **, ***)

When reporting results, clearly state the statistical methods used, the number of replicates, and the significance threshold (typically p < 0.05).

How can researchers interpret contradictory results in HtpX functional studies?

When faced with contradictory results in HtpX functional studies, researchers should follow a systematic approach to resolve inconsistencies:

  • Verify experimental conditions:

    • Check for differences in protein preparation methods

    • Compare buffer compositions, pH values, and temperature conditions

    • Assess protein purity and integrity in different preparations

    • Verify the presence of required cofactors (especially metal ions)

  • Consider biological context:

    • Evaluate differences between heterologous expression systems and native context

    • Assess potential post-translational modifications in different systems

    • Consider the impact of fusion tags on protein function

  • Address methodological limitations:

    • Compare sensitivity and specificity of different activity assays

    • Assess whether in vitro conditions reflect the in vivo environment

    • Consider whether membrane protein solubilization methods affect activity

  • Integrate multiple data types:

    • Combine biochemical, genetic, and structural approaches

    • Use complementary techniques to verify controversial findings

    • Consider whether seemingly contradictory results might reflect different aspects of HtpX function

  • Develop testable hypotheses:

    • Design experiments to directly address contradictions

    • Consider whether HtpX might have multiple functions or substrates

    • Test whether environmental conditions affect HtpX behavior

  • Collaborate and replicate:

    • Engage with other laboratories to independently verify results

    • Share detailed protocols to ensure methodological consistency

    • Consider blind replication of key experiments by different researchers

This systematic approach helps distinguish between genuine biological complexity and technical artifacts, leading to a more complete understanding of HtpX function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.