Recombinant Hyphomonas neptunium Protein CrcB homolog (crcB)

How does Hyphomonas neptunium relate taxonomically to other bacterial species and what does this tell us about CrcB evolution?

Despite initial 16S rRNA gene sequence phylogeny classifying H. neptunium within the order Rhodobacterales, multiple lines of evidence including 23S rRNA gene sequence analysis, concatenated ribosomal proteins, HSP70, and EF-Tu phylogenies support its classification as a member of the Caulobacterales . Genome analysis reveals that H. neptunium shares more genes with Caulobacter crescentus than with Silicibacter pomeroyi (which is a closer relative according to 16S rRNA phylogeny) .

This taxonomic relationship provides valuable insights into the evolution of the CrcB protein family. The evolutionary conservation of CrcB across these related but divergent species suggests an important biological function that has been maintained throughout evolutionary divergence. The conflicting phylogenetic evidence highlights the complexity of bacterial evolutionary relationships and the importance of using multiple genetic markers for taxonomic classification .

What are the recommended protocols for recombinant expression and purification of H. neptunium CrcB homolog?

Expression System:
The recombinant H. neptunium CrcB homolog can be effectively expressed using an in vitro E. coli expression system . For optimal results, the following methodological approach is recommended:

• Vector Selection: Design an expression construct containing the full-length crcB gene (expression region 1-127) with an N-terminal 10xHis tag for purification .

• Expression Conditions: Transform the expression vector into a suitable E. coli strain optimized for membrane protein expression. Induce protein expression at low temperature (16-20°C) to enhance proper folding of this transmembrane protein.

• Cell Lysis and Membrane Fraction Isolation:

  • Harvest cells by centrifugation

  • Resuspend in buffer containing protease inhibitors

  • Disrupt cells using sonication or French press

  • Isolate membrane fraction through ultracentrifugation

• Protein Solubilization: Solubilize membrane fractions using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to extract the transmembrane CrcB protein.

• Affinity Purification: Utilize Ni-NTA chromatography leveraging the His-tag for initial purification, followed by size exclusion chromatography for further purification if needed.

• Quality Control: Verify protein purity using SDS-PAGE and Western blotting with anti-His antibodies.

What are the optimal storage conditions for maintaining stability of recombinant CrcB protein?

For optimal stability of the recombinant H. neptunium CrcB homolog, the following storage conditions are recommended based on the product specifications:

Short-term storage (up to one week):

• Store working aliquots at 4°C

Medium-term storage:

• Store at -20°C in storage buffer containing 50% glycerol in Tris-based buffer optimized for this specific protein

Long-term storage:

• Store at -80°C in single-use aliquots to avoid repeated freeze-thaw cycles

Critical considerations:

• Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity

• The shelf life of the liquid form is typically 6 months at -20°C/-80°C, while the lyophilized form can be stable for up to 12 months

• For experimental work requiring repeated access to the protein, prepare multiple small-volume aliquots rather than using a single stock repeatedly

How can recombineering techniques be applied to study CrcB function in H. neptunium?

Recombineering offers powerful approaches for genetic manipulation of H. neptunium to study CrcB function. Based on established bacterial genetic engineering methods, researchers can implement the following strategies :

Lambda Red-based Recombineering Protocol for H. neptunium:

• Selection of Recombineering System:

  • Utilize the bacteriophage λ Red system (including genes gam, bet, and exo) for homologous recombination

  • Apply mobile recombineering systems such as pSIM vectors, mini-λ, or replication-defective λ phage (λTetR) for H. neptunium

• Transformation Protocol for H. neptunium:

  • Use conjugation with E. coli strain WM3064 (dap mutant) as a donor

  • Mix early-stationary-phase cultures of H. neptunium (2 ml) with E. coli WM3064 carrying the plasmid of interest (1 ml)

  • Wash cell pellets with MB medium and resuspend in 100 μl medium containing 300 μM DAP

  • Spot mixed suspensions onto MB-agar plates containing 300 μM DAP

  • After overnight incubation at 28°C, wash cells to remove DAP and plate on selective media

  • Incubate for 5 days at 28°C

• Strategic Approaches for CrcB Functional Analysis:

  • Gene Deletion: Design linear DNA constructs with homology arms flanking the crcB gene to create clean deletions

  • Point Mutations: Implement the "hit and fix" two-step recombineering approach to introduce specific mutations

  • Protein Tagging: Create fluorescently-tagged CrcB to study localization and dynamics within the cell

• Inducible Expression System:

  • Leverage the identified copper and zinc-inducible promoters specific to H. neptunium

  • These promoters exhibit low basal activity and high dynamic range, making them ideal for controlled expression studies

• Verification Methods:

  • Verify genetic modifications using colony PCR targeting the modified regions

  • Confirm alterations using restriction analysis and DNA sequencing

  • Validate protein expression using Western blotting with appropriate antibodies

What experimental approaches can reveal CrcB's role in H. neptunium's chromosome segregation process?

H. neptunium employs a unique two-step chromosome segregation process reminiscent of eukaryotic mitosis . To investigate CrcB's potential role in this process, the following experimental approaches are recommended:

1. Fluorescence Microscopy-Based Analysis:

• Create a ParB-YFP fusion strain to visualize chromosome origins during segregation as a baseline for comparison

• Generate a CrcB-fluorescent protein fusion to track its localization relative to the chromosomal origins

• Perform time-lapse microscopy to capture the dynamics of chromosome segregation through the stalk structure in wild-type and CrcB-modified strains

2. Conditional Depletion System:

• Develop a zinc-inducible promoter system to control CrcB expression levels

• Track chromosome segregation patterns under varying CrcB expression conditions

• Quantify segregation timing and efficiency using fluorescently-tagged origins

3. Protein Interaction Studies:

• Investigate potential interactions between CrcB and known chromosome segregation components like ParA and ParB

• Use bacterial two-hybrid assays or co-immunoprecipitation to detect physical interactions

• Perform ChIP-seq to identify potential DNA binding sites if CrcB directly interacts with chromosomal DNA

4. Comparative Analysis with Model Systems:

• Compare CrcB function in H. neptunium with homologs in C. crescentus

• Examine whether CrcB plays a role in the unique "mother cell replication and segregation followed by translocation" process that distinguishes H. neptunium

How does the transmembrane structure of CrcB relate to its proposed functions?

The CrcB homolog in H. neptunium is classified as a transmembrane protein , which has significant implications for its potential functions. Based on the amino acid sequence and comparative analysis with other CrcB homologs, the following structural-functional relationships can be explored:

Predicted Membrane Topology:

• The amino acid sequence (MNGFLLVALGGAIGASLRHGVGLVAVRHLPLGWPWGTSFVNIAGSLAMGLLAGWLALKAE GASQEARLFLATGVLGGFTTFSAFSLEVATMLRSGETLKAGLYAGVSVLLGVSALFIGLW MARRIFA) contains multiple hydrophobic regions consistent with transmembrane domains

• The protein likely spans the membrane multiple times, with hydrophilic regions forming loops that may participate in substrate binding or protein-protein interactions

Experimental Approaches to Characterize Structure-Function Relationships:

• Site-Directed Mutagenesis:

  • Target conserved residues in predicted functional domains

  • Analyze effects on protein localization and function

  • Create domain-specific deletions to identify essential regions

• Cysteine-Scanning Mutagenesis:

  • Introduce cysteine residues at specific positions in the protein

  • Use membrane-impermeable sulfhydryl reagents to determine membrane topology

  • Identify residues exposed to either side of the membrane

• Cryo-EM or X-ray Crystallography:

  • Determine high-resolution structure of purified CrcB protein

  • Identify structural motifs that may relate to function

  • Compare with structures of related proteins in other species

What controls and variables should be considered when designing experiments to study CrcB's role in H. neptunium's unique budding mechanism?

When investigating CrcB's potential role in H. neptunium's distinctive budding reproduction, experimental design should incorporate the following controls and variables:

Essential Controls:

• Wild-type Control:

  • Include unmodified H. neptunium to establish baseline budding dynamics

  • Quantify normal stalk formation, budding rates, and daughter cell release timing

• Genetic Complementation:

  • When studying CrcB mutants, include a complementation strain expressing wild-type CrcB

  • Verification that phenotypes can be rescued confirms specificity of the genetic manipulation

• Empty Vector Control:

  • For experiments using inducible promoters, include strains with empty vectors

  • Controls for potential effects of the expression system itself

Key Variables to Manipulate and Measure:

• Expression Levels:

  • Utilize copper and zinc-inducible promoters to create a gradient of CrcB expression

  • Compare phenotypes across varying concentrations of inducer

• Growth Conditions:

  • Examine budding under different growth phases (lag, exponential, stationary)

  • Assess effects of nutrient limitation, temperature, and osmotic conditions

  • Compare marine versus laboratory growth media effects

• Time-Course Measurements:

  • Track budding dynamics over complete cell cycles

  • Measure stalk elongation rates, bud formation timing, and division timing

  • Correlate CrcB localization with specific stages of the budding process

• Co-localization Analysis:

  • Track CrcB relative to known cell polarization markers

  • Examine relationship to chromosome segregation components

  • Investigate potential interactions with cytoskeletal elements

Quantification Methods:

• Time-lapse microscopy with automated image analysis

• Flow cytometry to quantify population-level phenotypes

• Growth curve analysis to detect subtle defects in reproduction efficiency

How does comparative genomic analysis of CrcB across bacterial species inform our understanding of its function in H. neptunium?

Comparative genomic approaches provide valuable insights into CrcB's evolutionary conservation and potential functions. Studies examining H. neptunium's genome in comparison to related bacteria reveal:

• Phylogenetic Distribution:

  • Despite H. neptunium being classified with Rhodobacterales based on 16S rRNA, it shares more genomic content with Caulobacterales like C. crescentus

  • This unusual phylogenetic positioning makes comparative analysis of CrcB particularly informative about functional conservation

• Conserved Genomic Context:

  • In H. neptunium, the parAB operon is located approximately 7 kb from the hemE gene, with parS sites upstream of this operon

  • Analyzing whether crcB maintains consistent genomic proximity to particular genes across species can indicate functional relationships

• Correlation with Reproduction Mechanisms:

  • Compare CrcB sequence conservation between bacteria that reproduce by budding versus binary fission

  • Identify CrcB sequence motifs that correlate with specific reproductive strategies

Methodological Approach for Comparative Analysis:

• Identify CrcB homologs across diverse bacterial species using BLAST searches

• Perform multiple sequence alignments to identify highly conserved regions

• Analyze genomic context of crcB genes across species to identify conserved gene neighborhoods

• Correlate CrcB sequence variations with specific phenotypic differences between species

• Use this information to generate testable hypotheses about CrcB function in H. neptunium

How can researchers resolve contradictory findings when studying CrcB function?

When investigating CrcB function, researchers may encounter contradictory findings due to the complexity of bacterial systems. Methodological approaches to resolve such contradictions include:

• Systematic Variation of Experimental Conditions:

  • Test CrcB function across different growth phases

  • Vary environmental conditions (temperature, salinity, nutrient availability)

  • Compare results in laboratory media versus natural marine environments

• Multiple Complementary Approaches:

  • Combine genetic, biochemical, and imaging approaches

  • Use both in vivo and in vitro experimental systems

  • Apply both gain-of-function and loss-of-function strategies

• Strain Background Considerations:

  • Verify genetic modifications in multiple independent clones

  • Consider potential second-site suppressors that may mask phenotypes

  • Test genetic modifications in different wild-type strain backgrounds when possible

• Addressing Technical Challenges:

  • For transmembrane proteins like CrcB, ensure proper solubilization techniques

  • Verify protein expression and localization before interpreting functional results

  • Consider potential artifacts from fusion proteins or overexpression systems

• Data Integration Framework:

  • Develop a coherent model that accounts for seemingly contradictory observations

  • Consider context-dependent functions that may explain variable results

  • Use mathematical modeling to test whether contradictory findings can be explained by a unified mechanism

What emerging technologies could advance our understanding of CrcB function in H. neptunium?

Several cutting-edge technologies hold promise for elucidating CrcB function in H. neptunium:

• CRISPR-Cas9 Genome Editing:

  • Adapt CRISPR systems for precise genetic manipulation in H. neptunium

  • Develop methods for creating clean deletions and point mutations

  • Establish CRISPRi systems for conditional gene repression

• Single-Cell Technologies:

  • Apply single-cell RNA-seq to identify transcriptional changes associated with CrcB function

  • Use single-molecule tracking to observe CrcB dynamics in living cells

  • Implement microfluidic approaches to study cell-to-cell variability

• Cryo-Electron Tomography:

  • Visualize CrcB in its native cellular context

  • Examine potential structural roles in membrane organization

  • Study its relationship to cytoskeletal elements during budding

• Systems Biology Approaches:

  • Perform global genetic interaction screens to identify functional relationships

  • Use proteomics to identify CrcB interaction partners

  • Develop computational models of budding that incorporate CrcB function

These emerging technologies can be combined with established approaches to develop a comprehensive understanding of CrcB's role in H. neptunium's unique cellular processes.