Recombinant Hyphomonas neptunium Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

UppP catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier required for:

  • Peptidoglycan precursor transport .

  • Teichoic acid and capsule biosynthesis .

  • Recycling of lipid intermediates after cell wall polymerization .

Catalytic Activity:
UPP (C55-PP)UppPUP (C55-P)+Pi\text{UPP (C}_{55}\text{-PP)} \xrightarrow{\text{UppP}} \text{UP (C}_{55}\text{-P)} + \text{P}_i
This reaction is magnesium-dependent and occurs at the periplasmic face of the cytoplasmic membrane .

Role in Antibiotic Resistance:

  • UppP confers low-level bacitracin resistance by competing with the antibiotic for UPP binding .

  • Deletion of uppP in Enterococcus faecalis reduces bacitracin MIC from 32–48 mg/L to 3–6 mg/L .

Research Applications

3.1. Cell Wall Synthesis Studies

  • Used to investigate UP/UPP dynamics in H. neptunium, a model for asymmetric cell growth .

  • Critical for understanding how bacteria prioritize lipid carrier usage under stress (e.g., SigM regulon activation in Bacillus subtilis) .

3.2. Antibiotic Development

  • Target for inhibitors disrupting cell wall recycling (e.g., bacitracin analogs) .

  • Structural insights from E. coli UppP homologs inform drug design .

3.3. Enzymatic Assays

  • Recombinant UppP enables in vitro phosphatase activity measurements using fluorescent probes like MX2401 .

  • Expression Optimization: Membrane localization complicates purification; E. coli systems yield insoluble protein requiring refolding .

  • Functional Redundancy: In B. subtilis, UppP works alongside BcrC/YodM, complicating knockout studies .

  • Structural Biology: No crystal structure exists for H. neptunium UppP; homology modeling relies on E. coli data .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; HNE_0091; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Hyphomonas neptunium (strain ATCC 15444)
Target Names
uppP
Target Protein Sequence
MSILQLVLIALMQGITEWLPISSSAHVMLVSDVVGLAGRDELLINAASNAGTLLAMLLYF RKDVAAAIAGGFELLGAPVTRKPLSAGGRLALCILVATPFALAGAVIYENFIPENIWTAL RSVYAVAASTIVFGALLWWADARGGQSRSEGDMTLRDAFLIGASQLVAVIIPGTSRSGIT MTAARALGYERVEAARFSMLIGAPILAAVSLYGLLGLATTPADGMGASLTDGLIVAALAF VSGYASIGLLMALLRKMSFLPFVLYRFALGIALLATSPIVAGAMG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (UppP) and what is its role in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (UppP) is an integral membrane enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to form undecaprenyl phosphate (UP), a critical recycling step in bacterial cell wall synthesis. The enzyme functions within the peptidoglycan synthesis pathway where UP serves as a lipid carrier for cell wall precursors that are transported across the cytoplasmic membrane . In the cytoplasmic stage of peptidoglycan synthesis, precursors are synthesized and attached to the lipid carrier, while in the periplasmic stage, these precursors are incorporated into the growing peptidoglycan layer . After the peptidoglycan subunits are transferred to the cell wall, the carrier lipid must be recycled via dephosphorylation by UppP to continue the process of cell wall formation . UppP activity is essential for bacterial viability, making it an attractive target for antimicrobial development, particularly as its function is not present in mammalian cells .

Why is Hyphomonas neptunium a valuable model organism for UppP research?

Hyphomonas neptunium has emerged as a valuable model organism for studying asymmetric cell morphology and reproduction through budding at the distal end of a stalk . This dimorphic Alphaproteobacterium exhibits distinctive cell wall growth patterns that differ from traditional rod-shaped bacteria like Escherichia coli and Bacillus subtilis, providing unique insights into specialized peptidoglycan synthesis mechanisms . H. neptunium's growth cycle involves multiple distinct phases of peptidoglycan synthesis, including both dispersed and zonal growth patterns that support its unusual morphology and budding process . The bacterium also features an unusually high incorporation of glycine instead of alanine at the 5th position of the peptidoglycan stem peptide, suggesting specialized peptidoglycan chemistry . These distinctive features make H. neptunium UppP particularly interesting for comparative studies of cell wall biosynthesis enzymes across bacterial species, potentially revealing adaptations that support specialized morphogenetic processes.

What are the fundamental characteristics of recombinant H. neptunium UppP?

Recombinant H. neptunium UppP is a membrane-associated phosphatase that belongs to the undecaprenyl pyrophosphate phosphatase family, acting as a critical enzyme in the lipid carrier recycling pathway of bacterial cell wall synthesis. Unlike some other bacterial phosphatases, H. neptunium UppP functions in a marine organism that must contend with high salt concentrations, suggesting potential adaptations in enzyme structure and function compared to freshwater bacterial homologs . The enzyme is believed to have multiple transmembrane domains, consistent with its role in processing membrane-embedded substrates, and its activity is likely essential for the complex growth pattern observed in H. neptunium . Expression of recombinant H. neptunium UppP typically requires careful optimization of conditions to maintain proper membrane insertion and folding, which are critical for preserving enzymatic activity. Functional characterization of the recombinant enzyme has demonstrated its ability to catalyze the dephosphorylation of undecaprenyl pyrophosphate to generate the undecaprenyl phosphate required for continued peptidoglycan biosynthesis.

How does the activity of H. neptunium UppP compare with UppP enzymes from other bacterial species?

The activity of H. neptunium UppP presents interesting comparisons with UppP enzymes from other bacterial species, particularly in terms of substrate specificity, kinetic parameters, and inhibition profiles. Unlike UppP from model organisms such as E. coli, H. neptunium UppP functions in a marine bacterium that experiences elevated ionic strength environments, which may impart distinctive adaptations in enzyme activity and stability . Comparative biochemical analysis suggests that while the core catalytic mechanism remains conserved, H. neptunium UppP may exhibit altered substrate binding affinity and catalytic efficiency that reflect its specialized environmental niche. Inhibition studies with compounds such as bacitracin, which is known to inhibit the UppP from E. coli with an IC₅₀ of approximately 32 μM, can provide valuable insight into the structural and functional differences between these homologous enzymes . Additionally, the high peptidoglycan turnover rate and unusual incorporation of glycine instead of alanine at the 5th position of the stem peptide in H. neptunium may indicate that its UppP has evolved to function within a distinctive peptidoglycan synthesis pathway compared to conventional model bacteria .

What structural features contribute to H. neptunium UppP function in a high-salt marine environment?

The structural features that enable H. neptunium UppP to function effectively in a high-salt marine environment likely involve specific adaptations in both the protein's primary sequence and tertiary structure. Marine bacterial enzymes typically display increased surface negative charge density through greater proportions of acidic amino acids, which facilitate solubility and stability in high ionic strength conditions . The transmembrane domains of H. neptunium UppP may contain amino acid compositions that support membrane integrity under osmotic stress, potentially with altered hydrophobic matching between protein and lipid bilayer compared to freshwater bacterial homologs. Structural analysis would likely reveal salt bridges and ion-binding sites that contribute to conformational stability in the presence of elevated cation concentrations typical of marine environments. Additionally, H. neptunium UppP may feature specialized substrate-binding pocket adaptations that maintain efficient catalysis despite altered electrostatic environments around the active site. Comparative molecular dynamics simulations between H. neptunium UppP and homologs from freshwater bacteria could illuminate how structural flexibility and rigidity are balanced to maintain enzyme function across different osmotic conditions.

How can inhibitors of H. neptunium UppP be designed as potential antimicrobial agents?

Inhibitor design for H. neptunium UppP should leverage structural knowledge of the enzyme's active site and substrate-binding pocket, with particular attention to features that distinguish it from human phosphatases. Initial screening approaches might utilize lipophilic benzoic acids with electron-withdrawing substituents, as these compounds have shown promise against undecaprenyl diphosphate phosphatase in other bacterial species with IC₅₀ values in the low micromolar range . Structure-activity relationship studies should explore modifications that enhance membrane permeability while maintaining target affinity, perhaps incorporating polar groups that mimic the pyrophosphate moiety of the natural substrate . Computational approaches including molecular docking and virtual screening can identify novel chemical scaffolds with predicted binding affinity to the enzyme's active site. A particularly promising approach involves designing compounds that act synergistically with existing cell wall-targeting antibiotics, as demonstrated by the benzoic acid derivative compound 7 (5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid), which showed synergistic effects with cell wall inhibitors (average FICI ~0.35) but not with antibiotics targeting other cellular processes (average FICI ~1.45) . Validation of candidate inhibitors should include both enzymatic assays with purified recombinant H. neptunium UppP and whole-cell growth inhibition studies to assess efficacy and specificity.

What challenges exist in expressing and purifying active recombinant H. neptunium UppP?

Expression and purification of active recombinant H. neptunium UppP presents several significant challenges due to its nature as an integral membrane protein. The hydrophobic transmembrane domains typically lead to protein aggregation, misfolding, and inclusion body formation when overexpressed in conventional bacterial systems, necessitating careful optimization of expression conditions including temperature, inducer concentration, and host strain selection. Membrane protein purification requires specialized detergents to solubilize the protein while maintaining its native fold and activity, with screening of multiple detergent types and concentrations being essential to identify optimal extraction conditions. The marine origin of H. neptunium introduces additional complexity, as the enzyme may require higher salt concentrations for stability, similar to the salt tolerance observed in other aspects of H. neptunium biology . Fusion constructs may improve expression and purification outcomes, with potential approaches including fusion to bacteriorhodopsin as successfully employed for E. coli UPPP . Verification of proper folding and activity following purification presents another significant challenge, requiring development of reliable activity assays that function in the presence of detergents or reconstitution into artificial membrane systems.

What expression systems are optimal for producing recombinant H. neptunium UppP?

Several expression systems can be employed for the production of recombinant H. neptunium UppP, each with specific advantages for membrane protein expression. E. coli-based systems utilizing specialized strains such as C41(DE3) or C43(DE3), derived from BL21(DE3), offer reduced toxicity during membrane protein overexpression and can be coupled with tightly controlled promoters such as T7lac to minimize basal expression . For homologous expression, the copper-inducible promoter system (Pcu) developed for H. neptunium provides an excellent alternative, as this system has been demonstrated to function effectively in the closely related H. baltica with precise control achieved through varying CuSO₄ concentrations from 10-500 μM . Yeast expression systems, particularly Pichia pastoris, offer advantages for complex membrane proteins through their eukaryotic protein processing machinery while still enabling high-density cultivation. Expression vectors should incorporate affinity tags such as polyhistidine or Strep-tag for purification, ideally with a protease-cleavable linker to remove the tag after purification. Codon optimization of the uppP gene sequence according to the selected expression host can significantly improve protein yields by addressing rare codon usage and optimizing mRNA secondary structures for efficient translation.

What assays can be used to measure the enzymatic activity of recombinant H. neptunium UppP?

Several complementary assays can be employed to quantify the enzymatic activity of recombinant H. neptunium UppP with varying degrees of throughput and sensitivity. A malachite green-based colorimetric assay provides a straightforward approach to measure released inorganic phosphate from the UppP-catalyzed reaction, with absorbance measured at 620-650 nm following color development . Radiolabeled substrate assays using [³²P]-labeled undecaprenyl pyrophosphate offer exceptional sensitivity and specificity, though they require specialized handling and disposal procedures. HPLC or LC-MS based methods can directly quantify the conversion of UPP to UP, providing detailed kinetic information while differentiating between multiple reaction products. For high-throughput screening of potential inhibitors, a fluorescence-based assay using synthetic fluorogenic phosphatase substrates provides rapid results, though validation with the natural substrate is essential for confirmed hits. Each assay format requires careful optimization of reaction conditions including buffer composition, pH, salt concentration, and presence of appropriate detergents or lipids to maintain enzyme activity in the in vitro setting. The table below compares key characteristics of these assay methods:

Assay MethodDetection LimitThroughputAdvantagesLimitations
Malachite Green~0.5-1 nmol PiMediumSimple, inexpensivePotential interference from buffers
Radiolabeled Substrate~0.1 nmolLowHighly sensitive, specificRequires radioactive materials
HPLC/LC-MS~0.2-0.5 nmolLowDirect product quantificationSpecialized equipment needed
Fluorogenic Substrate~0.2 nmolHighRapid, adaptable to screeningMay not reflect natural substrate kinetics

How can site-directed mutagenesis be used to study the catalytic mechanism of H. neptunium UppP?

Site-directed mutagenesis provides a powerful approach to probe the structure-function relationships and catalytic mechanism of H. neptunium UppP through systematic alteration of potentially critical amino acid residues. Initial targets for mutagenesis should focus on conserved amino acids identified through multiple sequence alignment with characterized UppP enzymes from other species, particularly focusing on predicted active site residues involved in substrate binding and catalysis . Conservative mutations (e.g., Asp to Glu) can distinguish between structural and functional roles of specific residues, while more dramatic alterations (e.g., Asp to Ala) can completely ablate activity if the residue is essential for catalysis. The copper-inducible promoter system established for H. neptunium provides an excellent platform for expressing mutant variants at controlled levels to prevent toxicity while enabling functional complementation studies in UppP-deficient strains . Each mutant should undergo comprehensive biochemical characterization including determination of kinetic parameters (Km, kcat) to quantify effects on substrate binding and catalytic efficiency. Combining mutagenesis with inhibitor binding studies can identify residues involved in inhibitor interactions, providing valuable information for structure-based drug design. Additionally, mutational analysis of transmembrane domains can reveal regions involved in proper membrane insertion and substrate access, aspects particularly relevant for membrane-embedded enzymes such as UppP.

How can recombinant H. neptunium UppP be reconstituted into liposomes for functional studies?

Reconstitution of recombinant H. neptunium UppP into liposomes provides a controlled membrane environment that better mimics native conditions compared to detergent-solubilized preparations. The process begins with preparation of detergent-solubilized purified UppP, typically containing affinity tags that have been removed if they might interfere with activity . Liposomes should be prepared from lipid mixtures that approximate bacterial membrane composition, with potential for including phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin at ratios similar to those in bacterial membranes. The detergent-mediated reconstitution method involves mixing the purified protein with detergent-destabilized liposomes, followed by controlled detergent removal through dialysis, adsorption onto hydrophobic resins, or dilution below the critical micelle concentration. Protein-to-lipid ratios typically range from 1:50 to 1:2000 (w/w), with optimization required to balance protein density against potential aggregation. Successful reconstitution should be verified through multiple techniques including freeze-fracture electron microscopy to visualize protein incorporation, sucrose density gradient centrifugation to separate proteoliposomes from empty liposomes, and functional assays to confirm retained enzymatic activity. Reconstituted UppP proteoliposomes enable studies of substrate accessibility from different membrane faces, lipid composition effects on activity, and development of inhibitor screening assays in a more physiologically relevant environment compared to detergent-solubilized preparations.

How does H. neptunium UppP contribute to the distinctive cell morphology and budding process?

H. neptunium UppP likely plays a specialized role in supporting the unique cell morphology and budding reproduction process of this dimorphic bacterium through spatiotemporally regulated peptidoglycan synthesis. The budding reproductive cycle of H. neptunium involves multiple distinct growth phases that can be divided into dispersed growth (swarmer cell growth and bud formation) and zonal growth (stalk biogenesis and cell division), each potentially requiring different levels of UppP activity to supply the necessary undecaprenyl phosphate carriers . Electron cryo-tomography has revealed that the stalk and bud form a continuum with the mother cell until cell division, with the daughter cell incorporating part of the mother cell's stalk during its development . This complex morphogenetic process requires precisely localized peptidoglycan synthesis, likely coordinated with localized UppP activity to ensure sufficient lipid carrier recycling at growth sites. The unusually high peptidoglycan turnover rate observed in H. neptunium suggests intensive remodeling during morphogenesis, which would necessitate robust UppP function to maintain adequate levels of lipid carriers . Future research using fluorescently tagged UppP could reveal whether the enzyme localizes to specific cellular regions during different growth phases, potentially coordinating with other peptidoglycan biosynthesis enzymes to support the asymmetric growth pattern characteristic of this species.

What role might H. neptunium UppP play in adaptation to varying ionic strengths in marine environments?

H. neptunium UppP likely plays a significant role in the organism's adaptation to varying ionic strengths encountered in marine environments, potentially through mechanisms that maintain cell wall integrity under osmotic stress. As a marine bacterium, H. neptunium must contend with fluctuating salt concentrations that can impact membrane fluidity, protein stability, and enzymatic activity . The cell wall, as a critical barrier between the cell and its environment, must maintain structural integrity while allowing for growth and division across various salinity conditions. Comparative analysis between marine and freshwater bacteria has revealed differences in ionic strength tolerance, suggesting specialized adaptations in cell wall biosynthesis enzymes such as UppP . UppP activity ensures adequate supply of the lipid carrier undecaprenyl phosphate, which is essential for transport of peptidoglycan precursors across the membrane for cell wall assembly . Modulation of UppP activity in response to changing salinity could potentially regulate the rate of peptidoglycan synthesis, allowing for cell wall modifications that enhance survival under osmotic stress. Future research comparing the kinetic properties of H. neptunium UppP under varying ionic strength conditions could reveal adaptations that support the enzyme's function across the range of salinities encountered in marine environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.