Recombinant Hypnale hypnale NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life can vary depending on factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Hypnale hypnale (Merrem's hump-nosed viper)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMVQILPTTKTDLFIPFIVLALWGATLANLTCLQQTDLK SLIAYSSISHMGLVVAAVIIQSPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMATTWWLLTNLMNIATPPTMNFTSELLIVSTLFNWCPTTIIMLGLSMLIT TTYSLHMFLSTQMGSPMLNYQTEPSHSREHLLMILHIIPLLMISMKPELVI
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered essential for the minimal assembly required for catalytic activity. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Hypnale hypnale MT-ND4 and what is its biological significance?

MT-ND4 (mitochondrial NADH-ubiquinone oxidoreductase chain 4) is a protein component of the mitochondrial electron transport chain Complex I in Hypnale hypnale, commonly known as Merrem's hump-nosed pit viper. This snake species is endemic to Sri Lanka and South India . As a mitochondrial protein, MT-ND4 plays a critical role in cellular energy production through oxidative phosphorylation.

The biological significance of studying MT-ND4 from Hypnale hypnale lies in understanding both the metabolic requirements of venomous snakes and potential evolutionary adaptations. While not directly identified as a venom component, research into mitochondrial proteins can provide insights into the high energy demands required for venom production and the snake's metabolic adaptations.

How does recombinant MT-ND4 differ from the native protein found in Hypnale hypnale?

Recombinant MT-ND4 is produced in laboratory expression systems rather than extracted directly from snake tissue. The recombinant protein is available in multiple expression systems including yeast, E. coli, baculovirus, and mammalian cells . These different expression systems may result in variations in post-translational modifications, folding, and activity compared to the native protein.

The recombinant versions may include additional elements not present in the native protein, such as purification tags or, in some cases, biotinylation. For example, one variant includes Avi-tag Biotinylation, where E. coli biotin ligase (BirA) catalyzes an amide linkage between biotin and a specific lysine in the AviTag peptide . These modifications facilitate research applications but may affect protein structure and function compared to the native form.

What are the current challenges in producing functional recombinant MT-ND4?

Producing functional recombinant mitochondrial proteins presents several challenges that researchers must address. Mitochondrial proteins often require specific chaperones and assembly factors that may not be present in heterologous expression systems. Additionally, mitochondrial genes like MT-ND4 use a slightly different genetic code, which necessitates codon optimization for expression in standard laboratory organisms.

The hydrophobic nature of many mitochondrial membrane proteins, including components of Complex I like MT-ND4, can complicate their expression and purification. This often requires optimization of detergents or nanodiscs to maintain proper folding and function. Expression yields may also be lower than for soluble proteins, requiring careful optimization of culture conditions and purification protocols.

How can researchers distinguish between different isoforms of Hypnale hypnale MT-ND4 in experimental settings?

Distinguishing between MT-ND4 isoforms requires a multi-faceted approach combining molecular and biochemical techniques. Researchers should begin with high-resolution gel electrophoresis coupled with western blotting using isoform-specific antibodies. Mass spectrometry provides more definitive identification, enabling detection of post-translational modifications and sequence variations that differentiate isoforms.

For functional studies, researchers might employ isoform-specific inhibitors or substrate preference analysis. Expression pattern studies using qPCR with isoform-specific primers can reveal tissue-specific or temporal variations in isoform expression. Given that Hypnale hypnale is found in both Sri Lanka and South India, geographic variation in MT-ND4 should be considered when designing experiments, as population-specific isoforms may exist that affect protein function or antigenicity .

What implications does MT-ND4 research have for understanding the pathophysiology of Hypnale hypnale envenomation?

While MT-ND4 itself is not identified as a venom component, research on this protein may indirectly contribute to understanding envenomation pathophysiology. Hypnale hypnale venom primarily contains phospholipase A2 (PLA2), snake venom metalloprotease (SVMP), snake venom serine protease (SVSP), L-amino acid oxidase (LAAO), and C-type lectin (CTL) . These components contribute to various pathologies including local tissue necrosis, thrombotic microangiopathy, and acute kidney injury.

Understanding mitochondrial function in the context of venom production may provide insights into the high metabolic demands required for venom synthesis. Additionally, studying how mitochondrial function is affected in tissues exposed to venom components could help explain some of the observed pathologies. For example, the case report describes a patient who developed various complications following HNV envenomation, including microangiopathic hemolytic anemia, which might involve mitochondrial dysfunction in affected tissues .

What are the comparative differences in MT-ND4 expression and function across different Hypnale species?

A comprehensive comparative analysis of MT-ND4 across Hypnale species would reveal evolutionary adaptations related to mitochondrial function. Three recognized species (H. hypnale, H. nepa/H. walli, and H. zara) plus the newly identified H. amal would form the basis for this comparison . Researchers should employ phylogenetic analysis of MT-ND4 sequences alongside functional studies to correlate sequence variations with differences in enzyme kinetics, stability, or regulatory properties.

RNA-seq data comparing expression levels across species in various tissues would provide insights into potential differences in mitochondrial energy production. Structural biology approaches, including crystallography or cryo-EM, would highlight species-specific structural adaptations. These comparisons are particularly valuable given the endemic status of most Hypnale species to Sri Lanka, making them an excellent model for studying island-specific evolutionary adaptations in mitochondrial function.

What expression systems are optimal for producing functional recombinant MT-ND4?

The selection of an expression system for MT-ND4 production depends on the research objectives and required protein characteristics. Currently, MT-ND4 is available from multiple expression systems, each with distinct advantages:

Expression SystemProduct IdentifierAdvantagesBest Applications
YeastCSB-YP015079HYD1Post-translational modifications, membrane protein foldingStructural studies, enzyme activity assays
E. coliCSB-EP015079HYD1High yield, cost-effective, rapid productionInitial characterization, antibody production
E. coli (Biotinylated)CSB-EP015079HYD1-BSite-specific biotinylation via AviTag-BirA technologyProtein interaction studies, pull-down assays
BaculovirusCSB-BP015079HYD1Complex folding, post-translational modificationsFunctional studies requiring authentic modifications
Mammalian cellCSB-MP015079HYD1Most authentic eukaryotic processingApplications requiring native-like function

For studies requiring interaction with other mitochondrial components, the mammalian or yeast systems are preferable as they provide the most physiologically relevant post-translational modifications. For structural studies requiring high protein yields, the E. coli system with subsequent refolding protocols may be optimal. The biotinylated option facilitates immobilization for binding assays or pull-down experiments .

What purification strategies yield the highest quality MT-ND4 for structural studies?

Purifying membrane proteins like MT-ND4 for structural studies requires specialized approaches. A multi-step purification strategy is recommended, beginning with affinity chromatography using the purification tag present in the recombinant construct. For biotinylated versions, streptavidin-based purification offers highly specific isolation .

Following initial purification, size exclusion chromatography separates monomeric protein from aggregates and contaminating proteins. For structural studies, detergent exchange during purification is critical, typically moving from harsh solubilization detergents to milder options compatible with structural techniques. Recent advances using nanodiscs or amphipols may better preserve native-like structure compared to traditional detergent micelles.

Purity assessment by SDS-PAGE should achieve >85% purity, as indicated for commercial preparations . For high-resolution structural studies, additional purification steps and careful buffer optimization to maintain stability over extended periods are essential.

How can researchers effectively study MT-ND4 interactions with other mitochondrial proteins?

Studying MT-ND4 interactions with other mitochondrial complex components requires specialized techniques that accommodate the hydrophobic nature of these proteins. Biotinylated MT-ND4 variants provide an excellent starting point, allowing for streptavidin-based pull-down assays to identify interaction partners . This approach can be coupled with mass spectrometry for unbiased identification of the protein interaction network.

Techniques like proximity labeling (BioID or APEX) can capture transient or weak interactions in the native cellular environment. For quantitative binding studies, microscale thermophoresis or bio-layer interferometry using the biotinylated MT-ND4 provide advantages over traditional methods like co-immunoprecipitation.

Functional reconstitution experiments combining purified MT-ND4 with other complex I components can verify direct interactions and assess their impact on enzymatic activity. For structural characterization of interaction interfaces, hydrogen-deuterium exchange mass spectrometry offers insights even when high-resolution structures are unavailable.

How does MT-ND4 research contribute to our understanding of snake venom evolution?

While MT-ND4 is not a venom component itself, its study provides valuable insights into the evolutionary history and relationships among venomous snakes. As a mitochondrial gene, MT-ND4 serves as a molecular marker for phylogenetic studies, helping reconstruct evolutionary relationships between Hypnale hypnale and other vipers. This phylogenetic context is crucial for understanding venom evolution.

The protein's sequence and structure may reflect adaptations to the high energy demands of venom production and delivery. Comparative studies between Hypnale species with different venom compositions could reveal correlations between mitochondrial adaptations and venom evolution. For example, understanding the phylogenetic relationship between Hypnale hypnale and the Malayan pit viper (Calloselasma rhodostoma), which has been reported to cause seizures following envenomation similar to those reported in some HNV cases, may provide insights into the evolution of neurotoxic components .

What techniques are most effective for studying MT-ND4's role in energy metabolism related to venom production?

Investigating MT-ND4's role in the energy metabolism supporting venom production requires techniques that bridge molecular biology and physiological function. Researchers should employ tissue-specific gene expression analysis comparing venom gland tissue with other tissues to determine if MT-ND4 is differentially expressed during venom production cycles.

Metabolic flux analysis using isotope-labeled substrates can track how energy production pathways are regulated during active venom synthesis. High-resolution respirometry measures mitochondrial respiration rates and efficiency in venom gland tissue compared to controls. Integration of these data with proteomics and metabolomics creates a comprehensive picture of the metabolic adaptations supporting the energetically demanding process of venom production.

In vivo studies examining how venom extraction and subsequent regeneration affect mitochondrial function in the venom gland provide physiologically relevant insights into the dynamic relationship between mitochondrial function and venom production.

How can MT-ND4 research inform our understanding of the pathophysiology observed in Hypnale hypnale envenomation?

Connecting MT-ND4 research to envenomation pathophysiology requires investigation of how mitochondrial function is affected in tissues exposed to Hypnale hypnale venom. Clinical manifestations of envenomation include local tissue necrosis, acute kidney injury, microangiopathic hemolytic anemia, and in rare cases, neurological symptoms including seizures . All of these could potentially involve mitochondrial dysfunction.

Researchers should design experiments to measure mitochondrial function in cell and tissue models exposed to HNV venom or isolated venom components. Parameters to assess include oxygen consumption, mitochondrial membrane potential, ROS production, and ATP synthesis. Particular attention should be paid to tissues most affected during envenomation, such as kidney, muscle, and neuronal cells.

Correlation of mitochondrial dysfunction with specific venom components could help explain the variable clinical presentations observed. For example, the unusually rapid onset of acute kidney injury in the case report might involve direct effects of venom components on renal mitochondria .

What are the most promising future research directions for Hypnale hypnale MT-ND4?

Future research on Hypnale hypnale MT-ND4 should pursue several promising directions that build upon current knowledge. Comparative genomics approaches examining MT-ND4 sequence and structure across all Hypnale species would provide evolutionary insights and potentially identify species-specific adaptations. This is particularly relevant given the different clinical presentations observed following envenomation by different Hypnale species.

Development of MT-ND4-specific antibodies or probes would enable detailed localization studies to understand tissue-specific expression patterns, particularly in venom gland tissue during different stages of venom production. Integration of MT-ND4 research with broader studies on mitochondrial function in venomous animals could reveal specialized adaptations supporting the energy-intensive process of venom production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.