Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF6 (ORF6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF6; Putative membrane protein ORF6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)
Target Names
ORF6
Target Protein Sequence
MNSLTIIFLLSGLTAYHAVLADGTGSSESVTAGDSGVVVLVMIGALLTLLMTIPIIGLFG IYVRTRASIEEMRGILMQIHLRLITGDQRSNRGDVELGAGASLLTISSQPPSYAEALLME PVEPQQQEGVPLEAEIRV
Uniprot No.

Target Background

Database Links

KEGG: vg:1488382

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Ictalurid herpesvirus 1 and its relationship to ORF6?

Ictalurid herpesvirus 1 (IHV-1), also known as Channel Catfish Virus (CCV), is a viral pathogen that affects channel catfish populations. The virus contains multiple open reading frames (ORFs), with ORF6 encoding a presumptive membrane protein that plays a significant role in viral structure and function . This protein has been identified as one of the key components for developing protective immunity against the virus in aquaculture settings . The full-length transcript of ORF6 has been successfully cloned following rt-PCR amplification and DNA sequencing, confirming it as a complete and unspliced transcript .

What are the structural characteristics of ORF6?

ORF6 is classified as a putative membrane protein, suggesting it contains hydrophobic domains that facilitate integration into lipid bilayers. While detailed crystallographic data is limited, functional studies indicate that ORF6 likely adopts conformations that allow it to associate with host cell membranes . When produced as a recombinant protein, ORF6 maintains structural elements critical for eliciting immune responses, particularly neutralizing antibodies in fish host systems .

How can recombinant ORF6 protein be effectively expressed and purified?

Recombinant expression of ORF6 typically involves cloning the complete ORF sequence into appropriate expression vectors designed for high-level protein production. For vaccine applications, researchers have successfully utilized expression constructs that support high levels of expression in catfish tissues . Purification protocols should account for the membrane-associated nature of the protein, often requiring detergent-based extraction methods. Companies like CUSABIO TECHNOLOGY LLC have developed standardized protocols for producing recombinant Ictalurid herpesvirus 1 ORF6 for research applications .

What analytical methods are recommended for validating recombinant ORF6?

Validation of recombinant ORF6 should encompass multiple analytical approaches:

  • SDS-PAGE and Western blotting for molecular weight confirmation

  • Mass spectrometry for sequence verification

  • Circular dichroism for secondary structure assessment

  • Functional assays to confirm immunogenic properties

  • Virus neutralization tests to verify biological activity

Researchers should ensure that the recombinant protein maintains critical epitopes present in the native viral protein to accurately represent its biological characteristics .

How does ORF6 contribute to viral pathogenesis in catfish?

ORF6's role in viral pathogenesis appears to be linked to its membrane association properties. As a presumptive membrane protein, ORF6 likely participates in virus assembly, membrane fusion during viral entry, or modification of host cell membranes . Expression studies have demonstrated that ORF6 is capable of inducing protective immunity when administered as a DNA vaccine, suggesting it plays a crucial role in host-pathogen interactions that trigger adaptive immune responses . Understanding these interactions requires sophisticated experimental approaches including:

  • Cell culture infection models

  • Immunofluorescence microscopy for localization studies

  • Co-immunoprecipitation to identify host protein interactions

  • Electron microscopy to visualize membrane alterations

What are the immunological mechanisms of ORF6-based protection?

Research indicates that ORF6 vaccination elicits virus-neutralizing antibodies that are capable of an anamnestic response upon viral challenge . The protective immunity induced by ORF6 likely involves both humoral and cell-mediated immune responses. Methodologically, researchers investigating these mechanisms should:

  • Perform detailed serology to characterize antibody responses

  • Analyze T-cell activation patterns following vaccination

  • Conduct adoptive transfer experiments to identify protective immune components

  • Use flow cytometry to quantify immune cell populations responding to the antigen

Notably, the combination of ORF6 with other viral components, particularly ORF59 (encoding an envelope glycoprotein), provides enhanced protection compared to either component alone, suggesting synergistic immune activation .

How can epitope mapping of ORF6 improve vaccine design?

Systematic epitope mapping of ORF6 would enable identification of immunodominant regions that elicit strong neutralizing antibody responses. This knowledge could inform the design of more effective subunit vaccines or multi-epitope constructs. Methodological approaches include:

  • Peptide arrays screening with immune sera

  • Phage display libraries expressing ORF6 fragments

  • Hydrogen-deuterium exchange mass spectrometry for structural epitope mapping

  • Computational prediction followed by experimental validation

Data from in vivo protection studies demonstrates that ORF6-based DNA vaccines provide consistent protection against viral challenge, indicating the presence of protective epitopes within this protein .

What are optimal parameters for DNA vaccine design using ORF6?

When designing DNA vaccines incorporating ORF6, researchers should consider:

  • Codon optimization for the target species (channel catfish)

  • Selection of vector systems that support high-level expression in fish tissues

  • Inclusion of appropriate promoter elements (e.g., CMV promoter)

  • Consideration of delivery methods (intramuscular injection has been successful)

  • Dose optimization (typically 1-10 μg of plasmid DNA)

Experimental evidence shows that single intramuscular injections of DNA expression constructs containing ORF6 can elicit strong resistance to viral challenge in 4-8 cm catfish . For maximal protection, researchers should consider combination approaches, as co-administration of ORF6 and ORF59 expression constructs has demonstrated superior protection compared to either construct alone .

What challenge models are appropriate for testing ORF6-based vaccines?

For evaluating the efficacy of ORF6-based vaccines, researchers should establish standardized challenge models that:

  • Utilize defined viral doses (e.g., one LD50 of CCV)

  • Include appropriate timing (challenge 4-6 weeks post-vaccination)

  • Measure both survival rates and kinetics of mortality

  • Include proper controls (unvaccinated, vector-only, and PBS-injected groups)

  • Assess viral loads in tissues following challenge

Published research has successfully employed challenge with one LD50 of CCV at 4-6 weeks post-vaccination, demonstrating that both percent survival and kinetics of cumulative deaths are improved using ORF6-containing vaccines .

How should researchers approach comparative studies between ORF6 and other viral antigens?

When conducting comparative studies:

  • Standardize expression levels across different constructs

  • Ensure equivalent delivery to target tissues

  • Use consistent challenge protocols

  • Include combination approaches to identify synergistic effects

  • Measure multiple immune parameters (antibody titers, cellular responses)

Experimental data indicates that while ORF6 and ORF59 individually provide protection, their combination elicits stronger resistance to challenge . This finding highlights the importance of evaluating both individual and combinatorial approaches when characterizing viral antigens for vaccine development.

How should researchers interpret neutralizing antibody responses to ORF6?

Analysis of neutralizing antibody responses should:

  • Compare pre- and post-vaccination titers

  • Assess anamnestic responses after challenge

  • Correlate antibody levels with protection outcomes

  • Compare responses between different vaccination regimens

Research has demonstrated that ORF6 vaccination elicits virus-neutralizing antibodies capable of an anamnestic response upon viral challenge, providing a critical parameter for assessing vaccine efficacy . The quality and quantity of these antibodies correlate with protection levels, offering a valuable surrogate marker for vaccine evaluation.

What statistical approaches are recommended for analyzing ORF6 vaccine efficacy data?

For robust statistical analysis:

  • Use survival analysis techniques (Kaplan-Meier curves, log-rank tests)

  • Apply appropriate tests for comparing multiple treatment groups (ANOVA with post-hoc tests)

  • Consider time-to-event analyses for mortality kinetics

  • Calculate relative percent survival (RPS) to quantify protection

  • Employ power calculations to ensure adequate sample sizes

The table below illustrates a typical format for presenting comparative vaccine efficacy data:

Vaccine ConstructNumber of FishSurvival Rate (%)Relative Percent SurvivalMean Time to Death (days)
PBS Control3045-5.2
Vector Only30485.55.5
ORF6307249.18.3
ORF59307554.58.7
ORF6 + ORF59308980.011.2

Note: This table is constructed based on the principles described in the research but with hypothetical values to illustrate data presentation format.

How can bioinformatic approaches enhance ORF6 research?

Bioinformatic analyses can provide valuable insights through:

  • Sequence comparisons with related viral proteins

  • Prediction of transmembrane domains and topology

  • Identification of potential antigenic regions

  • Structural modeling to inform functional studies

  • Analysis of evolutionary conservation to identify critical regions

These computational approaches can guide experimental design, helping researchers focus on functionally important domains within the ORF6 protein for detailed characterization and vaccine optimization.

What emerging technologies could enhance ORF6-based vaccine development?

Several cutting-edge approaches warrant investigation:

  • mRNA vaccine platforms for improved antigen expression

  • Novel adjuvant formulations to enhance immune responses

  • Nanoparticle delivery systems for improved vaccine stability

  • CRISPR-based approaches for precise genetic manipulation of ORF6

  • Systems biology approaches to comprehensively characterize immune responses

Building upon the established protective efficacy of DNA vaccines encoding ORF6 , these technological advances could further enhance vaccine potency, stability, and delivery efficacy in aquaculture settings.

How might structural biology techniques advance our understanding of ORF6?

Advanced structural characterization of ORF6 using:

  • Cryo-electron microscopy for native protein visualization

  • X-ray crystallography of purified protein or domains

  • NMR spectroscopy for dynamic structural analysis

  • Hydrogen-deuterium exchange mass spectrometry for conformational studies

  • Single-molecule techniques to observe protein-membrane interactions

These approaches would provide critical insights into the structural basis for ORF6 function, potentially revealing mechanisms of membrane association and interaction with host factors that could inform rational vaccine design.

What research gaps remain in understanding ORF6's role in viral pathogenesis?

Despite progress in utilizing ORF6 for vaccination, several knowledge gaps remain:

  • The precise molecular mechanism of ORF6's membrane association

  • Specific host protein interactions during infection

  • Temporal expression patterns during the viral life cycle

  • Potential role in immune evasion strategies

  • Structural determinants of immunogenicity

Addressing these gaps would enhance fundamental understanding of viral pathogenesis and potentially reveal new approaches for intervention in Ictalurid herpesvirus 1 infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.