Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF7 (ORF7)

Shipped with Ice Packs
In Stock

Description

Introduction to Ictalurid herpesvirus 1 and ORF7

Ictalurid herpesvirus 1 (IcHV-1), also known as channel catfish virus (CCV), is a virus that affects the catfish industry, leading to significant economic losses due to its high infectivity and pathogenicity . IcHV-1 causes channel catfish virus disease (CCVD), resulting in high mortality rates and reduced growth in catfish .

IcHV-1 is a herpesvirus with a double-stranded DNA genome of 134 kb, encoding 79 genes responsible for the infection and spread of the virus . The virus has a viral envelope and assembles in the nucleus .

ORF7 is a putative membrane protein of IcHV-1 .

ORF7 as a Putative Membrane Protein

ORF7 is described as a putative membrane protein, suggesting it is likely associated with the viral membrane .

ORF59 as a Glycoprotein of Ictalurid herpesvirus 1

While the focus is on ORF7, research on another glycoprotein, ORF59, provides insights into the functions of viral proteins in IcHV-1 infection . ORF59 is a viral membrane protein expressed at a late stage of infection .

Functional Studies of ORF59

  • Inhibitory Effect: Recombinant ORF59 protein has a dose-dependent inhibitory effect on virus invasion, suggesting it can block the virus from entering host cells .

  • Impact on Virus Production: Silencing ORF59 using a short hairpin (shRNA) decreases the production of infectious virus particles in channel catfish ovary cells .

ORF24 as an Immediate-Early Gene of Ictalurid herpesvirus 1

ORF24 is identified as an immediate-early (IE) gene in IcHV-1, localized predominantly in the nucleus . Functional studies in yeast reporter assays indicate that ORF24 can activate HIS3/lacZ reporter genes, suggesting it functions as a transcriptional regulator during IcHV-1 infection .

Oncolytic Virus Research

Studies involving oncolytic viruses, such as Herpes Simplex Virus Type 1 (HSV-1) recombinants, explore the potential of modified viruses to target and kill cancer cells . While this research does not directly involve Ictalurid herpesvirus 1 ORF7, it demonstrates the broader context of viral protein research for therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ORF7; Putative membrane protein ORF7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)
Target Names
ORF7
Target Protein Sequence
MAAVILERAAEFVAPGEARVGYPILAEVYRALTSDHEMRAFYETCAVSFFALFMLIIWVL HASRHPEGSTTRGTDAHTQTEGSTTRGTDAHTQTEGSRDQGSMTPEADDLTRPPLGHGRQ IPVLRRRMVLDRDLRIDYSL
Uniprot No.

Target Background

Database Links

KEGG: vg:1488392

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the genomic location and structure of ORF7 in Ictalurid herpesvirus 1?

ORF7 is located within the IcHV1 genome and encodes a putative membrane protein. While the specific genomic coordinates may vary depending on the reference strain used, ORF7 has been identified as part of the herpesvirus genomic architecture. Like other herpesviruses, IcHV1 demonstrates a complex gene expression program with temporal regulation, where genes are classified as immediate-early, early, early-late, and late based on their expression profiles during infection .

For analyzing the genomic context of ORF7, researchers should:

  • Use complete genome sequences available in GenBank

  • Employ bioinformatic tools to identify open reading frames and regulatory elements

  • Compare sequence conservation across different IcHV1 isolates

  • Analyze the promoter region for potential transcription factor binding sites

How is ORF7 expression regulated during viral infection?

Studies of herpesvirus gene expression patterns indicate that membrane proteins may be expressed with specific temporal kinetics. In the case of IcHV1, the expression of ORF7 has been characterized as producing both early and late transcripts, suggesting a complex regulatory mechanism . This dual expression pattern is important for the protein's function throughout the viral replication cycle.

To study ORF7 expression regulation, researchers should consider:

  • Time-course experiments with RT-qPCR analysis at various points post-infection

  • Use of protein synthesis inhibitors (like cycloheximide) to identify if ORF7 has immediate-early characteristics

  • Application of viral DNA polymerase inhibitors (like phosphonoacetic acid) to determine if ORF7 has true late gene characteristics

  • Analysis of 3'-coterminal transcript families, as ORF7 may be part of a polycistronic mRNA arrangement

What methods are recommended for cloning and expressing recombinant IcHV1 ORF7?

For researchers aiming to produce recombinant ORF7 protein, several expression systems have proven effective for herpesvirus membrane proteins. The baculovirus expression system in Sf9 insect cells has been successfully used for other IcHV1 glycoproteins like ORF59 .

The recommended protocol includes:

  • PCR amplification of the ORF7 coding sequence from viral DNA

  • Cloning into an appropriate expression vector (e.g., pFastBacTM HT A) with a purification tag

  • Generation of recombinant bacmid DNA through transformation of competent cells

  • Transfection of Sf9 cells to produce recombinant baculovirus

  • Infection of fresh Sf9 cells for protein expression

  • Purification using affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

The protein yield can be quantified using standard protein assays such as the Enhanced BAC Protein Assay .

How can researchers verify the membrane localization of ORF7?

Confirming the subcellular localization of ORF7 is essential for understanding its function. Multiple complementary approaches should be employed:

  • Biochemical fractionation: Separate membrane fractions from cytosolic components of infected cells and analyze by Western blot

  • Fluorescent tagging: Generate GFP or other fluorescent protein fusions with ORF7 by cloning into vectors like pEGFP-N3

  • Immunofluorescence: Use specific antibodies against ORF7 or its tags in fixed cells

  • Electron microscopy: For high-resolution localization within membrane structures

  • Protease protection assays: To determine membrane topology

What is the role of ORF7 in viral entry and how can this be experimentally determined?

As a membrane protein, ORF7 may play a role in viral attachment, fusion, or entry. Similar to studies on ORF59 , researchers can use protein blocking assays to determine ORF7's involvement in viral entry:

  • Express and purify recombinant ORF7 protein

  • Pre-incubate target cells with purified ORF7 at various concentrations

  • Challenge with infectious virus

  • Quantify infection rates compared to controls

  • Analyze dose-dependent inhibition patterns

Additionally, researchers should:

  • Generate ORF7-null mutants using BAC mutagenesis

  • Perform binding assays with labeled virions

  • Conduct cell-cell fusion assays with ORF7 expression constructs

  • Use time-of-addition experiments with ORF7-specific antibodies

How do post-translational modifications affect ORF7 function?

Herpesvirus membrane proteins often undergo extensive post-translational modifications that are critical for their function. For ORF7, researchers should investigate:

  • Glycosylation patterns using:

    • Treatment with glycosidases

    • Site-directed mutagenesis of potential glycosylation sites

    • Mass spectrometry analysis of purified protein

  • Phosphorylation status:

    • Phospho-specific antibodies

    • Radioactive labeling with 32P

    • Phosphatase treatments

  • Other modifications (palmitoylation, ubiquitination, etc.) using specific detection methods

ModificationDetection MethodFunctional Analysis
N-GlycosylationPNGase F treatmentCompare infectivity of wildtype vs. glycosylation mutants
O-GlycosylationO-Glycosidase treatmentAssess cell binding capacity of modified protein
PhosphorylationPhosphatase treatmentEvaluate impact on protein-protein interactions
PalmitoylationHydroxylamine treatmentDetermine effect on membrane association

What protein-protein interactions does ORF7 participate in during the viral replication cycle?

Understanding ORF7's interaction network is crucial for elucidating its function. Several complementary approaches can be employed:

  • Co-immunoprecipitation with ORF7-specific antibodies

  • Yeast two-hybrid screening against host and viral protein libraries

  • Proximity labeling techniques (BioID or APEX2)

  • Mass spectrometry-based interactome analysis

  • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

For each identified interaction, validation should include:

  • Reciprocal co-immunoprecipitation

  • Mapping interaction domains through truncation mutants

  • Assessing functional significance through competition assays

How can transcriptome analysis be used to understand ORF7 function in the context of viral infection?

Genome-wide transcriptional analysis can provide insights into ORF7's role in the viral life cycle. Researchers can:

  • Compare host gene expression profiles between wildtype and ORF7-mutant virus infections

  • Use RT-qPCR to quantify temporal expression patterns of ORF7 along with other viral genes

  • Employ RNA-Seq to identify 3'-coterminal transcript families that may include ORF7

  • Analyze the impact of ORF7 expression on host cell transcriptome using inducible expression systems

When conducting transcriptome analysis, researchers should consider:

  • Multiple time points post-infection (e.g., 2, 4, and 6 hours)

  • Use of appropriate reference genes (e.g., β-actin)

  • Biological replicates to ensure reproducibility

What are the optimal approaches for generating ORF7 knockout or mutant IcHV1?

Creating ORF7 mutants requires careful genetic manipulation of the viral genome. The BAC (Bacterial Artificial Chromosome) system offers an efficient approach for herpesvirus mutagenesis :

  • Construction of an IcHV1 BAC:

    • Direct insertion of BAC vector into the viral genome via homologous recombination

    • Selection of recombinant viruses using markers like GFP

    • Isolation of circular viral DNA and transformation into RecA-deficient E. coli

  • Mutagenesis strategies for ORF7:

    • Red recombination for precise deletions or substitutions

    • GalK positive/negative selection for scarless mutations

    • En passant mutagenesis for introducing point mutations

    • CRISPR/Cas9 approaches for targeted modifications

  • Complementation strategies:

    • Construction of cell lines stably expressing ORF7

    • Trans-complementation using expression plasmids

    • Rescue experiments with revertant viruses

What methods are most effective for studying ORF7 trafficking in infected cells?

Tracking the intracellular movement of ORF7 provides insights into its function. Researchers should consider:

  • Live-cell imaging techniques:

    • Fusion of ORF7 with fluorescent proteins (e.g., using pEGFP-N3 vector)

    • Photoactivatable or photoconvertible tags for pulse-chase imaging

    • SNAP-tag labeling for specific temporal visualization

  • Fixed-cell approaches:

    • Immunofluorescence with antibodies against ORF7 at different time points

    • Co-localization with markers for cellular compartments

    • Super-resolution microscopy for detailed localization

  • Biochemical approaches:

    • Subcellular fractionation at different time points post-infection

    • Biotinylation assays to track surface expression

    • Endocytosis assays using reversible biotinylation

How can RNA interference be used to study ORF7 function?

RNA interference offers a powerful approach to study ORF7 function through targeted knockdown. Based on techniques used for other IcHV1 genes :

  • Design of short hairpin RNAs (shRNAs):

    • Identify target sequences within ORF7 using established criteria

    • Design oligonucleotides with appropriate restriction sites (e.g., BamHI and BasI)

    • Clone into appropriate vectors (e.g., pGPU6-GFP-Neo)

  • Delivery methods:

    • Transfection into permissive cells prior to infection

    • Stable cell lines expressing shRNAs

    • Incorporation of shRNA expression cassettes into the viral genome

  • Evaluation of knockdown:

    • RT-qPCR to quantify mRNA reduction

    • Western blot to assess protein levels

    • Analysis of viral replication kinetics

    • Assessment of virion production and infectivity

What are the best approaches for studying the immunological properties of ORF7?

Understanding ORF7's interaction with the host immune system requires:

  • Antibody development:

    • Immunization with purified recombinant ORF7

    • Production of monoclonal antibodies

    • Generation of domain-specific antibodies

  • Epitope mapping:

    • Peptide arrays covering the ORF7 sequence

    • Alanine scanning mutagenesis

    • Competition assays with overlapping peptides

  • Host response analysis:

    • Cytokine profiling in response to ORF7 expression

    • Analysis of pattern recognition receptor activation

    • T-cell response assays

Immune ParameterExperimental ApproachExpected Outcome
Antibody responseELISA with purified ORF7Determination of antibody titers in infected animals
T-cell epitopesELISpot assays with synthetic peptidesIdentification of immunodominant epitopes
Innate immune activationReporter cell lines with PRR activation readoutsAssessment of ORF7's ability to trigger or evade innate immunity
Immune evasionFunctional assays with ORF7 wildtype vs. mutantsIdentification of immune evasion mechanisms

How should researchers interpret discrepancies between in vitro and in vivo studies of ORF7?

When faced with contradictory results between cell culture and animal studies:

  • Consider cellular tropism differences:

    • Compare results across multiple cell lines

    • Assess primary cells vs. established cell lines

    • Evaluate organ-specific cells that represent natural infection sites

  • Analyze temporal dynamics:

    • Extend time courses in vitro to better match in vivo conditions

    • Consider the impact of viral dose on expression kinetics

    • Account for immune responses present in vivo but absent in vitro

  • Methodological considerations:

    • Assess sensitivity limits of detection methods

    • Consider the impact of viral stock preparations

    • Evaluate experimental conditions that might affect ORF7 expression or function

What bioinformatic approaches are most valuable for analyzing ORF7 structure and function?

Computational analysis can provide crucial insights:

  • Structural prediction:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Secondary structure analysis (PSIPRED)

    • Tertiary structure modeling (I-TASSER, AlphaFold2)

    • Molecular dynamics simulations for functional domains

  • Comparative genomics:

    • Alignment with homologs from related herpesviruses

    • Identification of conserved functional motifs

    • Evolutionary analysis to identify selection pressure

  • Host-pathogen interaction predictions:

    • Binding site predictions for host receptors

    • Immune epitope prediction tools

    • Protein-protein interaction prediction

What are the current knowledge gaps regarding IcHV1 ORF7 and how should future research address them?

Despite advances in understanding herpesvirus membrane proteins, several knowledge gaps remain for IcHV1 ORF7:

  • Comprehensive experimental classification of ORF7 temporal expression patterns

  • Detailed structural characterization of the protein and its domains

  • Precise function in viral entry, assembly, or egress

  • Host interaction partners and their significance

  • Role in viral pathogenesis and host immune response

Future research should prioritize:

  • Development of ORF7-specific tools including antibodies and recombinant proteins

  • Generation of ORF7 mutant viruses using BAC technology

  • In vivo studies using natural host infection models

  • Integration of multi-omics approaches to place ORF7 in the broader context of viral-host interactions

  • Structural studies to guide potential therapeutic interventions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.