Recombinant Ictalurid herpesvirus 1 Putative membrane protein ORF8 (ORF8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF8; Putative membrane protein ORF8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Ictalurid herpesvirus 1 (strain Auburn) (IcHV-1) (Channel catfish herpesvirus)
Target Names
ORF8
Target Protein Sequence
MKCPRARVDIFKREIKTRELEPTEKNVYHGLTGPISLPPHNPVSIRFQEMVSWRLRSAVI GFFLLVSSTSGSSAASIPSAPTPDATRESPTGEPHRDRALSTETPTPEPSRDGGSTPEVL HVVTGPVRPRDRDPILERLAEILAETHSLHQLLTPGTGPREDEDEVFARALAAAEIAIGS VADRVMWKATLSCMLVVTSLVFAGVALWVIVARHGHFRVIPHERSRDWSPGL
Uniprot No.

Target Background

Database Links

KEGG: vg:1488376

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does Ictalurid herpesvirus 1 genome organization affect ORF8 expression?

    The genome structure of IcHV-1 features a unique arrangement of open reading frames that influences the temporal expression of genes including ORF8. Similar to other herpesviruses, the IcHV-1 genome has a specific organization where genes are expressed in a coordinated temporal cascade classified as immediate-early (IE), early (E), and late (L) genes .

    While specific classification of IcHV-1 ORF8 is not definitively established in the provided search results, comparative genomic analyses with related herpesviruses suggest it likely functions as an early or late gene based on its putative membrane protein characteristics. The genome arrangement takes into account minimal ORF overlap and locations of potential poly(A) signals downstream from individual ORFs or sets of ORFs that are transcribed 3' coterminally . This organization ensures proper expression timing during the viral replication cycle.

  • What experimental models are available for studying Ictalurid herpesvirus 1 ORF8?

    Several experimental models have been developed for studying Ictalurid herpesvirus 1 proteins including ORF8:

    • Cell culture systems: Channel catfish ovary (CCO) cells serve as the primary in vitro model for IcHV-1 infection studies .

    • Fish infection models: Experimental infection of channel catfish provides an in vivo model that mimics natural infection, particularly using immersion-infection protocols .

    • Recombinant protein expression systems: Baculovirus expression systems using sf9 insect cells have been successfully employed for expressing IcHV-1 proteins, as demonstrated with ORF59 .

    • DNA vaccination models: Experimental systems using plasmid constructs encoding viral ORFs, including ORF8, have been developed for immunization studies in channel catfish .

    These models provide researchers with options for investigating ORF8's function in different contexts, from molecular interactions to whole-organism responses.

Advanced Research Questions

  • What techniques are optimal for expression and purification of recombinant Ictalurid herpesvirus 1 ORF8?

    Based on successful approaches with related viral proteins, the following protocol is recommended for recombinant IcHV-1 ORF8 expression and purification:

    Expression System Selection:

    • The baculovirus expression system using sf9 insect cells has demonstrated success for IcHV-1 glycoproteins, as evidenced by ORF59 expression studies .

    • E. coli-based expression can be attempted for truncated versions lacking transmembrane domains.

    Optimized Expression Protocol:

    1. Clone the ORF8 coding sequence into an appropriate vector with His6 tag for purification

    2. For baculovirus expression:

      • Generate recombinant baculovirus containing His6-ORF8

      • Infect Sf9 cells at MOI of 5-10

      • Harvest cells and medium 72 hours post-infection

      • Use the harvested material to amplify next-generation baculoviral stock

    3. For protein purification:

      • Purify using Ni-NTA His- Bind® Resins following established protocols

      • Measure protein concentration using an Enhanced BAC Protein Assay kit

    Storage recommendations include maintaining purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage, with working aliquots kept at 4°C for up to one week .

  • How can researchers design functional assays to characterize Ictalurid herpesvirus 1 ORF8's role in viral pathogenesis?

    Based on successful approaches with related viral membrane proteins, researchers should consider these functional assay designs:

    Membrane Localization Assays:

    • Perform subcellular fractionation of infected cells to isolate membrane fractions

    • Use immunoblotting to detect the presence of ORF8 exclusively in membrane fractions

    • Confirm with digitonin solubilization experiments at different concentrations (0.035% and 0.2%) to determine luminal vs. membrane integration

    Protein Blocking Assays:

    • Express and purify recombinant His6-tagged ORF8 protein

    • Pre-incubate target cells with various concentrations of purified protein

    • Challenge with infectious virus and measure inhibition of viral entry

    • Quantify dose-dependent effects on viral invasion through plaque reduction assays

    Gene Silencing Approaches:

    • Design short hairpin RNAs (shRNAs) targeting ORF8

    • Transfect target cells with shRNA constructs

    • Measure the effect on viral replication through:

      • Viral titer determination

      • qPCR quantification of viral genome copies

      • Immunofluorescence detection of viral proteins

    Host-Protein Interaction Studies:

    • Employ co-immunoprecipitation to identify potential host binding partners

    • Use yeast two-hybrid or proximity labeling approaches

    • Validate interactions through microscopy-based colocalization studies

    These methodologies should be adapted based on specific research questions and available resources.

  • What is known about the temporal expression pattern of IcHV-1 ORF8 compared to other viral ORFs?

    While specific data on IcHV-1 ORF8 temporal expression is limited in the provided sources, viral gene expression in herpesviruses follows characteristic temporal patterns that can inform our understanding:

    Temporal Classification Framework:
    Herpesvirus genes are expressed in three sequential phases:

    • Immediate-Early (IE): Expressed without prior viral protein synthesis

    • Early (E): Require IE proteins for expression but precede viral DNA replication

    • Late (L): Expressed following viral DNA replication

    Experimental Determination Methods:
    The temporal classification of herpesvirus genes is experimentally determined using protein synthesis inhibitors (cycloheximide/CHX) and DNA synthesis inhibitors (cytosine-β-D-arabinofuranoside/Ara-C) .

    Comparative Analysis:
    In the related Cyprinid herpesvirus 2 (CyHV-2), researchers identified:

    • 5 IE genes (ORF54, ORF121, ORF141, ORF147, ORF155)

    • 34 E genes

    • 39 L genes

    While direct classification of IcHV-1 ORF8 is not provided, its putative membrane protein characteristics suggest it may belong to the early or late temporal class, similar to ORF59 which is expressed at late-stage infection . Definitive classification would require experimental verification following the inhibitor-based methods described for CyHV-2.

  • How does ORF8 function compare between Ictalurid herpesvirus 1 and other viral systems?

    Comparative analysis reveals both similarities and distinct functions of ORF8 proteins across different viral systems:

    VirusORF8 LocalizationPrimary FunctionsExperimental Evidence
    Ictalurid herpesvirus 1Putative membrane proteinPresumed role in virus-host cell interactionsLimited direct evidence; characterized as membrane protein
    SARS-CoV-2ER lumenImmune evasion; limits Spike availability; downregulates MHC-I; induces pro-inflammatory responseMHC-I downregulation; interaction with dendritic cells; promotion of cytokine secretion
    Bovine Herpesvirus 1Cell membraneInduces apoptosis; facilitates virus egressReduced cytotoxicity in ORF8 knockout; decreased virus release from infected cells

    The most striking contrast is observed between IcHV-1 ORF8 (putative membrane protein with limited functional characterization) and SARS-CoV-2 ORF8, which has been extensively studied and shown to have significant immunomodulatory functions . The BHV-1 US ORF8 protein demonstrates yet another functional specialization, regulating apoptosis to facilitate virus release .

    These comparative insights suggest that despite sharing the same designation, ORF8 proteins have evolved divergent functions across viral families, highlighting the importance of virus-specific characterization rather than functional inference based solely on naming conventions.

  • What contradictions exist in current research regarding Ictalurid herpesvirus 1 ORF8 function?

    The research landscape regarding IcHV-1 ORF8 contains several areas of uncertainty and potential contradictions:

    Functional Significance Contradictions:
    While the search results don't directly highlight contradictions specific to IcHV-1 ORF8, there are notable disparities in the effectiveness of ORF8-based interventions. DNA vaccination studies targeting multiple ORFs including ORF8 failed to provide significant protection against CCV , despite the protein's presumed importance as a membrane component.

    Methodological Challenges Contributing to Contradictions:

    1. Experimental Design Variations: Different studies employing varied infection protocols (e.g., immersion vs. injection) and fish populations with potentially different infection histories

    2. Technical Limitations: Challenges in generating consistent recombinant protein preparations and variations in purification methods

    3. Biological Complexity: The multifunctional nature of viral proteins makes isolating specific functions challenging, particularly when studying membrane-associated proteins

    4. Research Gaps: Limited direct functional studies on IcHV-1 ORF8 compared to other viral proteins like ORF59

    To address these contradictions, researchers should consider standardizing experimental approaches, implementing comprehensive protein characterization, and conducting comparative studies with other herpesviruses where ORF8 functions have been better characterized.

Research Methodology Questions

  • What approaches can be used to study ORF8's role in virus-host interactions?

    Several complementary approaches can elucidate IcHV-1 ORF8's role in virus-host interactions:

    1. Protein-Protein Interaction Studies:

    • Co-immunoprecipitation: Using anti-ORF8 antibodies to pull down potential host binding partners

    • Proximity Labeling: BioID or APEX2 approaches to identify proteins in close proximity to ORF8

    • Yeast Two-Hybrid Screening: For identifying direct protein-protein interactions

    • Surface Plasmon Resonance: For quantifying binding affinities with candidate host proteins

    2. Functional Genomics Approaches:

    • CRISPR-Cas9 Screening: To identify host factors essential for ORF8 function

    • Transcriptomics Analysis: RNA-seq of cells expressing ORF8 vs. controls to identify altered pathways

    • Proteomics Profiling: Mass spectrometry to identify changes in host protein expression/modification

    3. Virus Engineering:

    • Gene Knockout Studies: Generate ORF8-deficient IcHV-1 recombinants

    • Domain Mutation Analysis: Create targeted mutations in specific ORF8 domains

    • Reporter Fusion Constructs: Tag ORF8 with fluorescent proteins to track localization

    4. Structural Biology:

    • Cryo-EM or X-ray Crystallography: To determine ORF8 structure

    • In silico Modeling: For predicting interaction interfaces with host proteins

    5. Cell Biology Techniques:

    • Subcellular Fractionation: To confirm ORF8 localization

    • Immunofluorescence Microscopy: To visualize ORF8 distribution during infection

    • Flow Cytometry: To quantify effects on cell surface markers

    These approaches should be integrated to build a comprehensive understanding of ORF8's role in IcHV-1 pathogenesis.

  • How can researchers design experiments to evaluate the immunomodulatory potential of Ictalurid herpesvirus 1 ORF8?

    Drawing inspiration from studies on other viral ORF8 proteins, the following experimental design can evaluate the immunomodulatory potential of IcHV-1 ORF8:

    1. In Vitro Immunomodulation Assessment:

    Cytokine Production Assay:

    • Culture fish leukocytes or macrophages (primary isolates or cell lines)

    • Expose cells to purified recombinant ORF8 at varying concentrations

    • Quantify pro-inflammatory and anti-inflammatory cytokine expression via:

      • qRT-PCR for transcript analysis

      • ELISA for secreted cytokine measurement

      • Multiplex cytokine arrays for comprehensive profiling

    Immune Cell Activation Studies:

    • Evaluate the effect of ORF8 on fish dendritic cells or macrophages

    • Measure changes in activation markers via flow cytometry

    • Assess phagocytic activity and antigen presentation capacity

    2. Transcriptome Analysis:

    • Perform RNA-seq on immune cells exposed to ORF8

    • Conduct pathway enrichment analysis focusing on immune signaling

    • Compare with transcriptional responses to other viral proteins

    3. Protein Interaction Studies:

    • Screen for interactions with key fish immune receptors

    • Test binding to pattern recognition receptors

    • Evaluate effects on antigen presentation pathways

    4. In Vivo Immunomodulation Assessment:

    Recombinant Virus Studies:

    • Generate ORF8-knockout virus and wild-type controls

    • Infect fish and measure immune response parameters

    • Compare cytokine profiles, leukocyte populations, and antibody responses

    Vaccination-Challenge Experiments:

    • Immunize fish with recombinant ORF8 or control antigens

    • Challenge with virulent IcHV-1

    • Evaluate protection and immune correlates

    Statistical Analysis:

    • Employ appropriate statistical tests (ANOVA, t-tests) for group comparisons

    • Use multiple comparison corrections for cytokine panel analyses

    • Consider principal component analysis for multiparameter immune datasets

    This comprehensive approach would provide insights into whether IcHV-1 ORF8 possesses immunomodulatory functions similar to those observed with SARS-CoV-2 ORF8 .

  • What are the most effective methods for evaluating recombinant ORF8 protein quality and activity?

    Ensuring recombinant protein quality and confirming biological activity are crucial steps in researching IcHV-1 ORF8. Based on approaches used for similar viral proteins, the following methods are recommended:

    Protein Quality Assessment:

    Purity Analysis:

    • SDS-PAGE with Coomassie or silver staining (target >90% purity)

    • Western blotting with anti-His tag and anti-ORF8 antibodies

    • Mass spectrometry for identity confirmation and detection of post-translational modifications

    Structural Integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to confirm proper folding

    • Dynamic light scattering to detect aggregation

    Endotoxin Testing:

    • LAL (Limulus Amebocyte Lysate) assay to ensure endotoxin levels <1 EU/μg

    • Endotoxin removal if necessary using polymyxin B columns

    Functional Activity Assays:

    Binding Studies:

    • ELISA-based binding assays to potential host targets

    • Surface plasmon resonance for quantitative binding kinetics

    • Cell-based binding assays using flow cytometry

    Membrane Association:

    • Liposome incorporation assays

    • Cellular fractionation following transfection of ORF8

    • Immunofluorescence microscopy to confirm membrane localization

    Virus-Related Functional Assays:

    • Protein blocking assays to test inhibition of viral entry (as demonstrated for ORF59)

    • Competition assays with virus for cellular binding

    • Effects on viral replication in susceptible cell lines

    Expression Verification Protocol:

    1. Transfect target cells with ORF8-expressing construct

    2. Harvest cells 24-72 hours post-transfection

    3. Perform Western blot using appropriate antibodies

    4. Confirm expected molecular weight and subcellular localization

    Using these methods ensures that experimental findings can be confidently attributed to biologically relevant ORF8 activity rather than artifacts from improperly folded or contaminated protein preparations.

  • How can researchers accurately quantify ORF8 expression during different phases of viral infection?

    Accurate quantification of ORF8 expression throughout the viral infection cycle requires a multi-method approach targeting both RNA and protein levels:

    RNA-Level Quantification:

    RT-qPCR Method:

    1. Design primers specific to ORF8 with efficiency testing (90-110% efficiency)

    2. Establish a time course of infection (0-72h)

    3. Extract total RNA at defined timepoints

    4. Perform reverse transcription with oligo(dT) or random primers

    5. Conduct qPCR with appropriate reference genes (e.g., fish β-actin for host cells)

    6. Analyze using ΔΔCt or standard curve methods

    RNA-Seq Approach:

    • Perform high-throughput sequencing of infected cells at different timepoints

    • Map reads to the viral genome

    • Quantify ORF8 expression relative to other viral genes

    • This approach allows temporal classification based on expression patterns

    Protein-Level Quantification:

    Western Blot Analysis:

    1. Generate specific antibodies against ORF8 or use epitope tagging

    2. Harvest cells at multiple timepoints post-infection

    3. Perform subcellular fractionation to separate membrane fractions

    4. Conduct Western blotting with appropriate loading controls

    5. Use densitometry for semi-quantitative analysis

    Immunofluorescence Microscopy:

    • Fix infected cells at various timepoints

    • Perform immunostaining with anti-ORF8 antibodies

    • Quantify signal intensity using appropriate image analysis software

    • Co-stain with markers for different cellular compartments

    Inhibitor Studies for Temporal Classification:

    • Treat cells with cycloheximide (protein synthesis inhibitor) and cytosine-β-D-arabinofuranoside (DNA synthesis inhibitor)

    • Determine if ORF8 expression is:

      • Immediate-early (detected with both inhibitors)

      • Early (detected with DNA synthesis inhibitor only)

      • Late (not detected with either inhibitor)

    Data Integration and Analysis:

    • Compare RNA and protein expression profiles

    • Determine ORF8's temporal class within the IcHV-1 lifecycle

    • Correlate expression with virus production kinetics

    These complementary approaches provide a comprehensive view of ORF8 expression dynamics throughout infection.

Translational Research Questions

  • What are the potential applications of recombinant ORF8 in vaccine development against Ictalurid herpesvirus 1?

    Recombinant ORF8 offers several potential applications in vaccine development against IcHV-1, though researchers should be aware of both promises and limitations based on current evidence:

    Potential Vaccine Strategies:

    Subunit Vaccine Approaches:

    • Recombinant ORF8 protein could serve as an antigenic component in subunit vaccines

    • Combination with appropriate adjuvants might enhance immunogenicity

    • Could be administered via injection or immersion methods relevant to aquaculture

    DNA Vaccine Applications:

    • Plasmids encoding ORF8 can be used in DNA vaccination strategies

    • May induce both humoral and cell-mediated immune responses

    • Could be combined with other viral ORFs for multivalent protection

    Vector-Based Vaccines:

    • Viral vectors expressing ORF8 might enhance immunogenicity

    • Allows for in vivo expression of properly folded membrane protein

    Important Considerations and Limitations:

    Evidence of Limited Efficacy:
    Previous DNA vaccination studies including ORF8 have shown minimal protection against CCV challenge. In comprehensive evaluations, researchers found that:

    • DNA vaccines encoding membrane proteins including ORF8 failed to protect against disease

    • Neutralizing antibody titers were generally low and not significantly different between vaccinated and control groups

    • While immune responses (including Mx gene transcription) were detected, they were insufficient for protection

    Strategies to Overcome Limitations:

    1. Protein modifications: Engineering ORF8 for enhanced immunogenicity

    2. Adjuvant optimization: Testing novel adjuvants specific for fish immune systems

    3. Combination approaches: Using ORF8 as one component in multivalent vaccines

    4. Delivery optimization: Developing improved delivery methods for aquaculture settings

    Research Priorities:

    • Detailed characterization of immune responses to ORF8

    • Identification of protective epitopes within the protein

    • Optimization of expression systems for high-quality antigen production

    • Evaluation of cross-protection against diverse IcHV-1 strains

    While current evidence suggests limitations to ORF8-based vaccines alone, advancing our understanding of its immunogenicity could contribute to improved vaccination strategies against this economically significant fish pathogen.

  • How can knowledge of ORF8 function inform antiviral strategies against Ictalurid herpesvirus 1?

    Understanding ORF8 function can inform several promising antiviral strategies against IcHV-1:

    1. Protein-Based Inhibition Strategies:

    Recombinant Protein Blocking:
    Drawing from successful approaches with ORF59 , purified recombinant ORF8 could potentially inhibit viral entry through competitive binding with cellular receptors. This approach would involve:

    • Large-scale production of purified His6-tagged ORF8

    • Administration during high-risk periods

    • Dose optimization studies to determine effective concentrations

    Peptide Inhibitors:

    • Design of synthetic peptides based on functional domains of ORF8

    • Screening for inhibitory activity against viral attachment/entry

    • Delivery methods appropriate for aquaculture settings

    2. Gene Silencing Approaches:

    RNA Interference Technology:

    • Development of short hairpin RNAs (shRNAs) targeting ORF8 mRNA

    • Design of small interfering RNAs (siRNAs) with optimal stability for aquatic applications

    • Delivery vehicles suitable for administration to fish

    Based on findings from knockdown studies of other viral proteins, ORF8 silencing could potentially decrease viral particle production .

    3. Small Molecule Inhibitors:

    Structure-Based Drug Design:

    • Determination of ORF8 structure through crystallography or modeling

    • Virtual screening for compounds that bind critical domains

    • Rational design of inhibitors that disrupt ORF8 function

    High-Throughput Screening:

    • Development of cell-based assays measuring ORF8 function

    • Screening of compound libraries for inhibitors

    • Optimization of lead compounds for efficacy and safety

    4. Host-Targeted Approaches:

    Pathway Modulation:

    • Identification of host pathways essential for ORF8 function

    • Targeting these pathways with existing approved compounds

    • Development of specific modulators with minimal host toxicity

    5. Prevention Strategies Based on ORF8 Knowledge:

    Environmental Intervention:

    • Understanding of how ORF8 contributes to viral stability in water

    • Development of water treatment approaches targeting viral entry

    Implementation Considerations:

    • Efficacy validation in relevant cell culture and fish models

    • Safety assessment for aquaculture applications

    • Cost-effectiveness analysis for commercial implementation

    • Environmental impact evaluation

    By targeting ORF8 and understanding its role in the viral lifecycle, researchers can develop multimodal approaches to controlling IcHV-1 infections in aquaculture settings.

  • How does genomic variation in Ictalurid herpesvirus 1 ORF8 affect virus-host interactions and potential therapeutics?

    Genomic variation in IcHV-1 ORF8 has important implications for virus-host interactions and therapeutic development:

    Genomic Variation Analysis:

    While specific data on ORF8 variation across IcHV-1 isolates is limited in the provided search results, insights can be drawn from comparative genomic analyses of herpesviruses. The genome structure of IcHV-1 and related herpesviruses reveals important considerations:

    • Structural Conservation: Core functional domains in herpesvirus membrane proteins often show evolutionary conservation, while non-essential regions may exhibit greater variability

    • Functional Implications: Variations in ORF8 sequence could potentially affect:

      • Membrane topology and protein localization

      • Host receptor binding specificity

      • Immune recognition and evasion

      • Virulence and tissue tropism

    Impact on Virus-Host Interactions:

    Potential consequences of ORF8 variation include:

    1. Altered Host Range: Modifications in receptor-binding domains could affect which fish species or cell types support viral replication

    2. Immune Evasion: Variation in antigenic epitopes might enable escape from host antibody recognition

    3. Virulence Modulation: As observed with SARS-CoV-2 ORF8 where knockout affects clinical outcomes , variations in IcHV-1 ORF8 could potentially influence disease severity

    Implications for Therapeutic Development:

    ORF8 variation necessitates specific approaches in developing effective interventions:

    1. Vaccine Design Considerations:

      • Incorporation of conserved epitopes to ensure broad protection

      • Multivalent vaccines covering known variants

      • Regular genomic surveillance to detect emerging variants

    2. Antiviral Drug Development:

      • Targeting highly conserved functional domains

      • Combination therapies to prevent resistance development

      • Structure-based design accounting for known variations

    3. Diagnostic Implications:

      • Primers and probes targeting conserved regions for reliable detection

      • Multiplex assays capable of detecting variants

      • Regular updating of diagnostic tools based on surveillance data

    Research Recommendations:

    To address these challenges, researchers should:

    1. Conduct comprehensive genomic surveillance of IcHV-1 isolates from different geographic regions

    2. Perform functional characterization of ORF8 variants

    3. Develop in vitro and in vivo models to assess the impact of variation on pathogenesis

    4. Design broadly effective interventions targeting conserved domains

    This approach will ensure that therapeutic strategies remain effective despite genomic variation in ORF8.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.