Recombinant Ictalurus punctatus Cyclic nucleotide-gated cation channel

What is the protein structure and composition of the recombinant Ictalurus punctatus cyclic nucleotide-gated cation channel?

The recombinant protein consists of the full-length (1-682aa) cyclic nucleotide-gated cation channel from Ictalurus punctatus (channel catfish), fused to an N-terminal His tag and expressed in E. coli. The complete amino acid sequence is:

MTGQAALERSVSSHRLSVRSRLEGEAERAESAISRTDGDDDTCSELQRVTALELPSAEML EAFTQRRPLARLVNLVLSLREWAHKSLVETEQRPDSFLERFRGPQAANDQSAAPADAPKK TFKERWEGFVVSQSDDIYYYWLFFIALASLYNWIMLVARACFDQLQDENFFLWVGLDYLC DVIYILDTCIRLRTGYLEQGLLVKDLAKLRDNYIRTLQFKLDFLSILPTELLFFVTGYVP QLRFNRLLRFSRMFEFFDRTETRTNYPNAFRICNLILYILVIIHWNACIYYAISKALGLS SDTWVYSGQNKTLSFCYVYCFYWSTLTLTTIGEMPPPVKDEEYVFVVFDFLVGVLIFATI VGNVGSMIANMNATRAEFQTRIDAIKHYMHFRKVNRTLETRVIKWFDYLWTNKKTVDEQE VLKNLPDKLRAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVYSPGDYICRKGDI GKEMYIIKEGQLAVVADDGVTQFALLTAGGCFGEISILNIQGSKMGNRRTANIRSIGYSD LFCLSKDDLMEAVAEYPDAQKVLEERGREILRKQGLLDESVAAGGLGVIDTEEKVERLDA SLDILQTRFARLLGEFTSTQRRLKQRITALERQLCHTGLGLLSDNEAEGEHAGVPTHTHA DIHAQPETHTRTSAETNSEEET

The protein is supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis. It is stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How should the recombinant protein be handled and stored for optimal stability?

For proper handling and storage of this recombinant protein, follow these methodological guidelines:

• Upon receipt, store the lyophilized protein at -20°C to -80°C

• Brief centrifugation of the vial is recommended prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended 50%) and aliquot for long-term storage

• Store working aliquots at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this may compromise protein integrity

What is the functional role of cyclic nucleotide-gated cation channels in the olfactory system of Ictalurus punctatus?

Cyclic nucleotide-gated (CNG) cation channels play a crucial role in the olfactory signal transduction pathway of channel catfish. These channels are involved in:

• Depolarization of olfactory receptor neurons (ORNs) following odorant binding to olfactory receptors

• Mediation of cation influx (particularly Ca²⁺) in response to cyclic nucleotide binding

• Formation of the electrical signal that ultimately leads to action potentials in the ORNs

• Integration of multiple olfactory signaling pathways that may include both cAMP and cGMP-dependent mechanisms

Research with channel catfish ORNs has demonstrated their ability to respond to odorant stimuli (amino acids, bile salts, and ATP) with either excitation or suppression of background neural activity, with both excitatory and suppressive responses sometimes elicited from the same ORN. This suggests the presence of different olfactory receptor molecules and different transduction pathways within the same ORN .

What experimental approaches are recommended for studying the ion channel properties of recombinant Ictalurus punctatus CNG channels?

To characterize the ion channel properties of recombinant Ictalurus punctatus CNG channels, researchers should consider these methodological approaches:

• Electrophysiological techniques:

  • Patch-clamp recordings (whole-cell, inside-out, and outside-out configurations) to measure channel conductance, ion selectivity, and gating properties

  • Two-electrode voltage clamp in Xenopus oocytes expressing the recombinant channel

  • Implementation of fast solution exchange systems to analyze activation/deactivation kinetics

• Fluorescence-based assays:

  • Ca²⁺ imaging with fluorescent indicators to monitor channel activity in cell populations

  • Voltage-sensitive dye imaging to assess membrane potential changes

• Structural studies:

  • Site-directed mutagenesis to identify critical residues for cyclic nucleotide binding and channel gating

  • Protein crystallography or cryo-EM approaches for high-resolution structural analysis

  • Fluorescence resonance energy transfer (FRET) to analyze conformational changes during gating

• Comparative analysis:

  • Parallel studies with mammalian CNG channels to identify conserved and divergent functional properties

How can researchers investigate the physiological role of CNG channels in olfactory signal transduction in Ictalurus punctatus?

To investigate the physiological role of CNG channels in olfactory signal transduction in Ictalurus punctatus, researchers should implement a multi-level experimental approach:

• In vivo single-cell recordings:

  • Record responses from single olfactory receptor neurons while simultaneously measuring the electroolfactogram (EOG)

  • Quantify spontaneous activity patterns (which range from <1 to 12 action potentials/s with a mean frequency of 4.7 ± 2.5 action potentials/s in catfish ORNs)

  • Analyze both excitatory and suppressive responses to odorant stimuli

• Pharmacological interventions:

  • Apply specific CNG channel blockers to assess their effects on odorant-evoked responses

  • Use inhibitors of the cAMP pathway to determine the contribution of cAMP-dependent versus cAMP-independent mechanisms

  • Test cyclic nucleotide analogs to characterize channel sensitivities

• Molecular profiling:

  • Perform single-cell RNA sequencing to identify co-expression patterns of CNG channel subunits with specific olfactory receptors

  • Use immunohistochemistry to map the distribution of CNG channels in the olfactory epithelium

• Comparative functional studies:

  • Design experiments similar to those performed with CNGA2 knock-out mice to identify potential cAMP-independent olfactory pathways in catfish

What are the recommended protocols for expressing and purifying functional recombinant Ictalurus punctatus CNG channels for structural studies?

For expressing and purifying functional recombinant Ictalurus punctatus CNG channels suitable for structural studies, consider this methodological workflow:

• Expression system selection:

  • E. coli systems are suitable for producing the full-length protein with N-terminal His-tag

  • Consider insect cell expression systems (Sf9, High Five) for improved post-translational modifications

  • Mammalian cell expression (HEK293, CHO) for studies requiring native-like glycosylation

• Optimization of expression conditions:

  • Test various induction temperatures (16-37°C) and durations

  • Optimize inducer concentrations and media compositions

  • Consider co-expression with chaperones to improve folding

• Purification strategy:

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

  • Size exclusion chromatography for further purification and buffer exchange

  • Consider detergent screening to identify optimal conditions for membrane protein extraction and stability

• Functional verification:

  • Implement reconstitution into liposomes or nanodiscs to verify channel function

  • Apply electrophysiological techniques to confirm ion channel activity

  • Use circular dichroism or fluorescence spectroscopy to assess proper folding

What approaches can be used to study the cyclic nucleotide binding domain (CNBD) of the Ictalurus punctatus CNG channel?

To study the cyclic nucleotide binding domain (CNBD) of the Ictalurus punctatus CNG channel, researchers should implement these methodological approaches:

• Domain-specific expression and purification:

  • Express the isolated CNBD for detailed structural and functional studies

  • Compare results with the full-length channel to understand allosteric regulation

• Ligand binding assays:

  • Radiolabeled or fluorescent cyclic nucleotide binding assays to determine affinity (K₁)

  • Isothermal titration calorimetry (ITC) to characterize thermodynamic parameters

  • Surface plasmon resonance (SPR) for kinetic analysis of binding events

• Structural studies:

  • X-ray crystallography of the isolated CNBD with and without bound ligands

  • NMR spectroscopy to investigate dynamics of ligand-induced conformational changes

  • Hydrogen-deuterium exchange mass spectrometry to identify ligand-induced protection patterns

• Molecular dynamics simulations:

  • Perform in silico modeling of cyclic nucleotide binding and induced conformational changes

  • Predict critical residues involved in ligand recognition and channel gating

• Mutagenesis studies:

  • Create point mutations in conserved residues of the CNBD

  • Assess effects on ligand binding affinity and channel gating

  • Perform comparative analysis with CNBDs from mammalian CNG channels

How can comparative studies between mammalian and Ictalurus punctatus CNG channels inform evolutionary understanding of olfactory systems?

Comparative studies between mammalian and Ictalurus punctatus CNG channels can provide valuable insights into the evolution of olfactory systems through these methodological approaches:

• Sequence and structural comparisons:

  • Perform phylogenetic analyses of CNG channel sequences across vertebrate lineages

  • Identify conserved domains and species-specific variations

  • Map conservation patterns onto known structural models

• Functional comparisons:

  • Compare electrophysiological properties (conductance, ion selectivity, gating kinetics)

  • Analyze cyclic nucleotide sensitivity differences (cAMP vs. cGMP preference)

  • Study differences in regulation by calcium/calmodulin and phosphorylation

• Alternative signaling pathway investigation:

  • Assess the relative importance of cAMP-dependent vs. cAMP-independent pathways

  • Compare the findings from mouse CNGA2 knockout studies showing odor detection via alternative pathways with similar studies in fish models

  • Investigate the relationship between CNG channel diversity and ecological niche specialization

• Receptor-CNG channel coupling:

  • Examine species-specific differences in the linkage between olfactory receptors and downstream CNG channel activation

  • Compare signaling cascade components across species

• Behavioral correlates:

  • Connect molecular differences to species-specific olfactory behaviors and sensitivities

  • Examine adaptation to aquatic versus terrestrial olfaction

Evidence from mouse models indicates that even with disruption of the CNGA2 gene, mice can still detect certain odorants through cAMP-independent pathways. Similar comparative studies with catfish CNG channels could reveal evolutionary conservation or divergence of these alternative pathways .

What quality control measures should be implemented when working with recombinant Ictalurus punctatus CNG channels?

When working with recombinant Ictalurus punctatus CNG channels, implement these quality control measures:

• Purity assessment:

  • SDS-PAGE analysis to confirm >90% purity of the recombinant protein

  • Western blot with anti-His tag antibodies to verify identity

  • Mass spectrometry to confirm protein mass and detect potential post-translational modifications

• Functional validation:

  • Cyclic nucleotide binding assays to confirm ligand recognition

  • Reconstitution into artificial membranes followed by electrophysiological measurements

  • Circular dichroism spectroscopy to verify secondary structure integrity

• Stability monitoring:

  • Differential scanning fluorimetry to assess thermal stability

  • Size-exclusion chromatography to detect aggregation during storage

  • Activity assays after various storage durations to establish shelf-life

• Batch-to-batch consistency:

  • Maintain detailed records of expression conditions and purification parameters

  • Implement standardized functional assays for each batch

  • Prepare reference standards for comparative analysis

• Contaminant testing:

  • Endotoxin testing for E. coli-expressed proteins

  • Nucleic acid contamination assessment

  • Host cell protein detection using sensitive immunoassays

How can researchers effectively design structure-function studies to elucidate the gating mechanism of Ictalurus punctatus CNG channels?

To effectively design structure-function studies for elucidating the gating mechanism of Ictalurus punctatus CNG channels, researchers should consider this methodological framework:

• Comprehensive sequence analysis:

  • Perform multiple sequence alignments with CNG channels from diverse species

  • Identify conserved residues in transmembrane domains and cyclic nucleotide binding regions

  • Map conservation patterns onto available structural models of CNG channels

• Targeted mutagenesis strategy:

  • Design alanine scanning mutagenesis of transmembrane domains

  • Create chimeric constructs between catfish and mammalian CNG channels

  • Implement cysteine accessibility methods to probe structural rearrangements

• Functional characterization:

  • Apply patch-clamp electrophysiology to characterize wild-type and mutant channels

  • Use voltage-clamp fluorometry to correlate structural movements with functional states

  • Implement single-channel recordings to assess effects on conductance and gating kinetics

• Structure determination approaches:

  • Utilize cryo-electron microscopy for high-resolution structure determination

  • Implement molecular dynamics simulations to model conformational changes during gating

  • Apply computational approaches to predict cyclic nucleotide-induced conformational changes

• Integration with physiological context:

  • Correlate structure-function findings with olfactory response profiles in intact neurons

  • Examine how specific structural elements contribute to specialized olfactory functions in aquatic environments

What experimental considerations are important when investigating the interaction between recombinant CNG channels and potential modulatory proteins?

When investigating interactions between recombinant Ictalurus punctatus CNG channels and potential modulatory proteins, consider these experimental guidelines:

• Interaction detection methods:

  • Co-immunoprecipitation assays using anti-His tag antibodies

  • Pull-down assays with recombinant modulatory proteins

  • Surface plasmon resonance to measure binding kinetics and affinity

  • Proximity ligation assays for detecting interactions in cellular contexts

• Functional impact assessment:

  • Patch-clamp electrophysiology before and after application of modulatory proteins

  • FRET-based assays to monitor conformational changes induced by protein interactions

  • Calcium imaging to assess changes in channel activity in cell populations

• Experimental controls:

  • Use unrelated proteins of similar size and charge as negative controls

  • Include known interaction partners as positive controls

  • Perform competition assays to confirm specificity of interactions

• Physiological relevance:

  • Verify co-expression of the channel and modulatory proteins in native tissues

  • Manipulate endogenous levels of modulatory proteins and assess effects on channel function

  • Consider the impact of cellular microenvironment (pH, calcium concentration, redox state)

• Structural characterization:

  • Map interaction interfaces using deletion constructs and point mutations

  • Consider co-crystallization attempts for detailed structural analysis

  • Use cross-linking mass spectrometry to identify interaction sites

How can researchers integrate findings from recombinant CNG channel studies with native olfactory receptor neuron responses in Ictalurus punctatus?

To bridge the gap between recombinant protein studies and native neuronal function, researchers should implement a multi-level integration strategy:

• Comparative electrophysiology:

  • Directly compare the biophysical properties of recombinant channels with those recorded in native ORNs

  • Assess spontaneous activity patterns (ranging from <1 to 12 action potentials/s with a mean of 4.7 ± 2.5 action potentials/s in native ORNs)

  • Compare odorant response profiles between recombinant systems and intact neurons

• Molecular profiling of native tissues:

  • Perform single-cell RNA sequencing of catfish ORNs to identify the complete complement of CNG channel subunits expressed

  • Use in situ hybridization to map spatial distribution of channel subunits

  • Implement immunohistochemistry to localize channel proteins within the olfactory epithelium

• Functional manipulation approaches:

  • Develop strategies for selective inhibition or modification of CNG channels in native neurons

  • Use pharmacological tools validated in recombinant systems on intact olfactory epithelium

  • Consider viral transduction approaches to express modified channels in native neurons

• Correlation with behavioral responses:

  • Design behavioral assays to measure olfactory sensitivity in intact animals

  • Correlate molecular/electrophysiological findings with behavioral thresholds

  • Assess the impact of specific odorants that engage different transduction pathways

• Integrated modeling:

  • Develop computational models that incorporate findings from both recombinant and native systems

  • Use these models to generate testable predictions about olfactory system function

  • Refine models based on experimental feedback

What are common challenges in expressing and purifying functional Ictalurus punctatus CNG channels, and how can they be addressed?

Researchers often encounter several challenges when working with membrane proteins like CNG channels. Here are methodological solutions to common issues:

• Low expression levels:

  • Optimize codon usage for the expression host

  • Test different promoter systems and expression conditions

  • Consider fusion tags that enhance expression (e.g., MBP, SUMO)

  • Implement auto-induction media for E. coli expression

• Protein misfolding and aggregation:

  • Express at lower temperatures (16-20°C)

  • Co-express with molecular chaperones

  • Add stabilizing agents during purification (glycerol, specific lipids)

  • Use mild detergents for membrane protein extraction

• Protein instability after purification:

  • Screen different buffer conditions (pH, salt concentration, additives)

  • Add stabilizing agents such as trehalose (6% is recommended)

  • Maintain high glycerol concentrations (up to 50%) for storage

  • Consider nanodiscs or amphipols for maintaining native-like environment

• Loss of function during purification:

  • Minimize exposure to harsh conditions during purification

  • Verify functional activity at each purification step

  • Consider purification in the presence of cyclic nucleotides to stabilize active conformation

  • Implement rapid purification protocols to minimize time outside native environment

• Difficulties in functional characterization:

  • Develop robust reconstitution protocols for functional studies

  • Optimize lipid composition for reconstitution

  • Consider planar lipid bilayer or patch-clamp of proteoliposomes

  • Implement fluorescence-based functional assays as alternatives to electrophysiology

How can researchers reconcile contradictory data between recombinant channel studies and native tissue observations?

When faced with discrepancies between recombinant system data and native tissue observations, implement these methodological approaches:

• Systematic comparison of experimental conditions:

  • Create a detailed comparison table of all experimental variables

  • Identify key differences in ionic conditions, temperature, and other parameters

  • Systematically test each variable to identify sources of discrepancy

• Subunit composition analysis:

  • Verify the exact subunit composition of native channels versus recombinant constructs

  • Test heteromeric assemblies that may better represent native configurations

  • Consider the impact of auxiliary subunits that may be present in native systems

• Post-translational modification assessment:

  • Investigate potential phosphorylation, glycosylation, or other modifications in native channels

  • Implement mass spectrometry to identify modifications in native tissues

  • Test the functional impact of these modifications in recombinant systems

• Membrane environment considerations:

  • Analyze lipid composition differences between expression systems and native membranes

  • Test reconstitution in lipid mixtures that mimic the native membrane environment

  • Consider the impact of membrane microdomains on channel function

• Cellular context integration:

  • Examine the influence of intracellular modulatory proteins present in native cells

  • Consider signaling cascades that may affect channel function in intact cells

  • Develop more complex expression systems that incorporate relevant cellular components

What advanced techniques can be applied to study the conformational dynamics of Ictalurus punctatus CNG channels during gating?

To investigate conformational dynamics during channel gating, researchers should consider these advanced methodological approaches:

• Single-molecule FRET:

  • Engineer FRET pairs at strategic positions to monitor distance changes during gating

  • Perform measurements in reconstituted systems with controlled cyclic nucleotide application

  • Correlate FRET changes with electrophysiological recordings

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Compare exchange patterns between apo and cyclic nucleotide-bound states

  • Identify regions with altered solvent accessibility during gating

  • Map dynamic changes onto structural models

• Electron paramagnetic resonance (EPR) spectroscopy:

  • Introduce spin labels at key positions in the channel

  • Monitor distance changes and environmental alterations during gating

  • Implement double electron-electron resonance (DEER) for long-range distance measurements

• Time-resolved cryo-electron microscopy:

  • Capture different conformational states using rapid freezing after cyclic nucleotide application

  • Reconstruct the trajectory of conformational changes during the gating process

  • Correlate structural snapshots with functional states

• Molecular dynamics simulations:

  • Perform extensive simulations of the channel in membrane environments

  • Model cyclic nucleotide binding and subsequent conformational changes

  • Use enhanced sampling techniques to capture rare transition events

  • Validate computational predictions with experimental measurements

By implementing these advanced techniques, researchers can develop a comprehensive understanding of the complex conformational dynamics that underlie CNG channel function in olfactory signal transduction.

How might comparative studies between Ictalurus punctatus and other species' CNG channels inform drug discovery and therapeutic approaches?

Comparative studies between Ictalurus punctatus and other species' CNG channels can significantly contribute to drug discovery through these methodological approaches:

• Identification of conserved binding sites:

  • Perform detailed sequence and structural alignments across species

  • Identify highly conserved pockets suitable for drug targeting

  • Design compounds that selectively target specific CNG channel subtypes

• Species-specific pharmacological profiles:

  • Develop comprehensive pharmacological profiles of catfish versus mammalian CNG channels

  • Identify compounds with differential effects between species

  • Use these differences to design more selective modulators

• Structure-based drug design:

  • Leverage structural insights from fish CNG channels to complement mammalian models

  • Implement virtual screening approaches targeting conserved and divergent domains

  • Design allosteric modulators based on species-specific regulatory mechanisms

• Therapeutic implications:

  • Explore the potential of CNG channel modulators for olfactory disorders

  • Investigate applications in neurological conditions involving cyclic nucleotide signaling

  • Consider applications in vision disorders, as CNG channels play crucial roles in photoreceptors

• Safety assessment approach:

  • Use evolutionary divergence to predict potential off-target effects in humans

  • Implement cross-species testing to improve prediction of drug effects

  • Develop screening platforms incorporating CNG channels from multiple species

What emerging technologies might advance our understanding of Ictalurus punctatus CNG channel function in the olfactory system?

Emerging technologies that could revolutionize our understanding of Ictalurus punctatus CNG channel function include:

• Cryo-electron tomography:

  • Visualize CNG channels in their native cellular environment

  • Map the three-dimensional organization of signaling complexes in olfactory cilia

  • Correlate structural organization with functional compartmentalization

• Genetically encoded sensors:

  • Develop cyclic nucleotide sensors to monitor real-time changes in cAMP/cGMP levels

  • Create calcium indicators targeted to specific subcellular compartments

  • Implement voltage indicators to map electrical activity across the olfactory epithelium

• CRISPR-based approaches:

  • Generate targeted modifications in CNG channel genes in vivo

  • Create reporter lines for visualizing channel expression and trafficking

  • Implement base editing for precise modification of key residues

• Organ-on-chip technologies:

  • Develop microfluidic platforms that recreate the olfactory epithelium

  • Enable controlled delivery of odorants and pharmacological agents

  • Facilitate high-throughput screening of compounds affecting CNG channel function

• Computational approaches:

  • Implement deep learning to predict structure-function relationships

  • Develop systems biology models of the entire olfactory transduction cascade

  • Use artificial intelligence to identify patterns in large datasets of channel responses