Recombinant Ictalurus punctatus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we accommodate specific format requests. Please indicate your preferred format during order placement for personalized preparation.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We select the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Ictalurus punctatus (Channel catfish) (Silurus punctatus)
Target Names
rho
Target Protein Sequence
YEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLYVTIEHKKLRTPLNYILLNLAVAN LFMVFGGFTTTMFTSIRGYFVLGHLGCNLEGFFATLSGEIALWSLVVLAIERWVVVCKPI SNFRFGENHAIMGLAFTWTMAMACAAPPLVGWSRYIPEGMQCSCGIDYYTRAEGFNNESF VVYMFTCHFMTPLTIVFFCYGRLLCAVKEAAAAQQESETTQRAEREVTRMVVIMVIAFLI CWCPYAGVAWFIFTHQGSEFGPVFMTIPAFFAKSSSIYNPMIYICLNKQFRHCMITTLCC GKKA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor crucial for image-forming vision under low light conditions. While most marine fish species utilize retinal as a chromophore, most freshwater fish employ 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Database Links

UniGene: Ipu.42854

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the molecular structure of Ictalurus punctatus rhodopsin?

Ictalurus punctatus rhodopsin is a G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) family of sensory receptors within the opsin group. The protein consists of 304 amino acids organized into seven transmembrane domains (TM1-TM7), intracellular loops (ICL1-ICL3), extracellular loops (ECL1-ECL3), and a C-terminal helix (H8). The protein has distinct N-terminal and C-terminal regions, with the C-terminal ending in GKKA . This structural arrangement is critical for its function in phototransduction, as it allows the protein to change conformation upon light absorption, triggering downstream signaling cascades.

How does the amino acid sequence affect rhodopsin function?

The specific amino acid sequence of Ictalurus punctatus rhodopsin determines its spectral sensitivity, activation kinetics, and thermal stability. The transmembrane regions contain highly conserved residues that form the retinal binding pocket, while variable residues in the loops influence interaction with G proteins and other signaling molecules . Of particular importance are the residues in TM3, TM5, and TM6, which undergo significant conformational changes during photoactivation. When studying recombinant rhodopsin, researchers should note that even single amino acid substitutions can dramatically alter protein function and stability .

What are the key functional domains in channel catfish rhodopsin?

The key functional domains in channel catfish rhodopsin include:

  • Retinal binding pocket: Formed by residues predominantly in TM3, TM5, and TM7

  • G protein interaction sites: Located primarily in ICL2, ICL3, and the C-terminal region

  • Dimerization interfaces: Involving TM1, TM2, and H8

  • Extracellular loops: Particularly ECL2, which contributes to rhodopsin stability

Each of these domains plays a specific role in either light detection or signal transduction. The retinal binding pocket accommodates the chromophore 11-cis-retinal, which isomerizes to all-trans-retinal upon light absorption. This conformational change propagates through the transmembrane domains to expose G protein binding sites in the intracellular regions .

What expression systems are optimal for recombinant Ictalurus punctatus rhodopsin production?

For recombinant expression of Ictalurus punctatus rhodopsin, several expression systems can be employed with varying advantages:

  • Mammalian cell lines (HEK293, COS-7): These provide proper post-translational modifications and folding machinery for functional rhodopsin. Culture conditions typically involve DMEM with 10% FBS at 37°C with 5% CO₂.

  • Insect cell expression (Sf9, High Five): The baculovirus expression system offers high yield and proper folding. Cells should be maintained at 27°C in serum-free medium.

  • Cell-free expression systems: These can be advantageous for rapid production but may require additional steps to ensure proper folding.

When expressing recombinant rhodopsin, it's crucial to perform all manipulations under dim red light to prevent unwanted photoactivation. Additionally, supplementation with 11-cis-retinal (typically 5-10 μM) during expression or purification is necessary to obtain the functional holoprotein .

How can single-molecule tracking be used to study rhodopsin dynamics?

Single-molecule tracking provides valuable insights into rhodopsin clustering and diffusion dynamics. Based on the methodologies in recent studies, researchers can implement the following protocol:

  • Label rhodopsin with appropriate fluorescent probes that don't interfere with function

  • Utilize total internal reflection fluorescence microscopy (TIRFM) with near-IR wavelength to minimize photoactivation

  • Record single-molecule movements at high frame rates (typically 30-100 fps)

  • Apply variational Bayes hidden Markov model (HMM) analysis to infer diffusive states and transition rates

This approach has revealed that rhodopsin exhibits multiple diffusive states in native disc membranes. All fluorescently labeled rhodopsin molecules are mobile, with diffusion coefficients varying between different states. The analysis shows that rhodopsin typically exists in three diffusive states with distinct characteristics .

What methods can assess light-dependent changes in rhodopsin dynamics?

To assess light-dependent changes in rhodopsin dynamics, researchers can employ several complementary approaches:

  • Single-molecule diffusion analysis before and after illumination: This reveals changes in mobility states. Studies show that in the absence of GTP, light exposure increases the occupancy of slower diffusive states, suggesting rhodopsin clustering .

  • Spectroscopic assays: UV-visible spectroscopy can monitor the conversion of rhodopsin (λmax ~500 nm) to metarhodopsin II (λmax ~380 nm) upon illumination.

  • FRET-based approaches: By labeling rhodopsin with donor and acceptor fluorophores, researchers can detect light-induced conformational changes and protein-protein interactions.

Data from these methods can be analyzed to determine transition rates between different conformational and diffusive states, providing insights into the molecular mechanisms of rhodopsin signaling .

How do rhodopsin clusters affect G protein signaling efficiency?

Rhodopsin forms dynamic clusters in native disc membranes, which significantly impacts G protein signaling efficiency. Single-molecule tracking studies reveal that rhodopsin exists in at least three diffusive states, with the slower states likely representing clustered rhodopsin molecules .

These clusters serve as signaling platforms that enhance the activation of G proteins (transducin) by:

  • Concentrating activated rhodopsin molecules in specific membrane domains

  • Creating a favorable lipid environment for G protein coupling

  • Increasing the probability of productive encounters between photoisomerized rhodopsin and transducin

Research indicates that in darkness, rhodopsin primarily occupies a medium-diffusivity state. Upon light activation and in the absence of GTP, rhodopsin shifts to a slower diffusive state, indicating increased clustering. This light-dependent clustering is reversible by the addition of GTP, suggesting that G protein binding and dissociation regulate rhodopsin organization .

What is the significance of rhodopsin dimerization in photoreceptor function?

Rhodopsin dimerization plays a crucial role in photoreceptor function through several mechanisms:

  • Enhanced signal amplification: Dimers and higher-order oligomers create platforms for efficient G protein activation, potentially amplifying the single-photon response.

  • Altered diffusion dynamics: Dimerized rhodopsin shows distinctive diffusion characteristics, with IgG-crosslinked rhodopsin exhibiting an almost identical three-state hidden Markov model to light-activated rhodopsin .

  • Lipid raft association: Dimerized rhodopsin shows increased raftophilicity, which affects its membrane distribution and interaction with signaling partners.

Experimental evidence indicates that stabilized rhodopsin dimers act as condensation nuclei for rhodopsin-cluster rafts, even in darkness. Cholesterol depletion disrupts these clusters, restoring the diffusion dynamics to those observed in dark-adapted conditions . This suggests that manipulating membrane cholesterol content could be a strategy to modulate rhodopsin signaling in experimental systems.

How do evolutionary adaptations affect rhodopsin kinetics?

Evolutionary adaptations in rhodopsin kinetics are particularly evident in high-altitude catfish lineages. Statistical analyses reveal parallel acceleration of evolutionary rates in rhodopsin in high-altitude species, although the specific substitution sites differ between Andean and Himalayan lineages .

Functional studies demonstrate that these high-altitude-specific amino acid substitutions significantly accelerate the kinetic rates of rhodopsin, particularly destabilizing the ligand-bound forms. This adaptation likely compensates for cold-induced decreases in kinetic rates, as is commonly observed in cold-adapted enzymes .

The table below summarizes key differences in rhodopsin properties between lowland and high-altitude catfish species:

PropertyLowland SpeciesHigh-Altitude Species
Evolutionary RateStandardAccelerated
Kinetic RatesLowerHigher
Thermal StabilityHigherLower
Ligand BindingMore stableLess stable

These adaptations represent a case of functional convergence achieved through parallel shifts in evolutionary rates but via different molecular mechanisms in separate lineages .

What techniques are used to study rhodopsin-membrane interactions?

Several specialized techniques can be employed to investigate rhodopsin-membrane interactions:

  • Fluorescence Recovery After Photobleaching (FRAP): Measures lateral diffusion of rhodopsin in membranes, providing insights into membrane fluidity and protein mobility.

  • Atomic Force Microscopy (AFM): Visualizes rhodopsin organization in native or reconstituted membranes at nanometer resolution.

  • Solid-State NMR: Provides atomic-level information about rhodopsin-lipid interactions and conformational changes.

  • Molecular Dynamics Simulations: Computationally models rhodopsin behavior in different membrane environments.

For recombinant Ictalurus punctatus rhodopsin, membrane composition significantly affects protein stability and function. Research indicates that raftophilic rhodopsin clusters form platforms for G protein signaling, and these clusters are sensitive to membrane cholesterol content . When designing experiments, researchers should consider that depletion of cholesterol can disrupt these clusters and alter rhodopsin diffusion dynamics.

How can one measure the spectral properties of recombinant rhodopsin?

Accurate measurement of spectral properties is essential for characterizing recombinant rhodopsin. The following methodological approach is recommended:

  • Sample preparation: Purify recombinant rhodopsin in detergent micelles or reconstitute into lipid nanodiscs or liposomes.

  • UV-Visible absorption spectroscopy: Record spectra between 250-650 nm before and after photobleaching. Ictalurus punctatus rhodopsin typically exhibits an absorption maximum around 500 nm.

  • Difference spectroscopy: Calculate the difference between dark and bleached spectra to determine the specific contribution of the chromophore.

  • Thermal stability assessment: Monitor the decay of the characteristic absorption peak at different temperatures to determine thermal stability.

  • pH dependence: Measure spectra at various pH values to assess the effects of protonation states on spectral properties.

All spectroscopic measurements should be performed under dim red light (>650 nm) to prevent unwanted photoactivation. Temperature control is critical, as spectral properties can vary significantly with temperature, particularly for cold-adapted species like Ictalurus punctatus .

What approaches can identify critical residues for rhodopsin function?

Identifying critical residues for rhodopsin function requires a multi-faceted approach:

  • Sequence alignment and evolutionary analysis: Compare rhodopsin sequences across species to identify conserved and variable regions. Studies on catfish rhodopsin reveal accelerated evolution at specific sites in high-altitude lineages .

  • Site-directed mutagenesis: Systematically replace potential key residues and assess functional consequences. Focus on:

    • Retinal binding pocket residues

    • G protein interaction sites

    • Dimerization interfaces

  • Structure-function studies: Correlate mutational effects with structural features using techniques such as:

    • Spectroscopy to assess chromophore binding

    • G protein activation assays

    • Thermal stability measurements

  • Molecular dynamics simulations: Predict the effects of mutations on protein dynamics and ligand interactions.

Research on high-altitude catfish rhodopsin demonstrates that substituting Andean- or Himalayan-specific residues significantly accelerates kinetic rates, destabilizing ligand-bound forms . This highlights how even subtle changes in amino acid composition can have substantial functional consequences, adapting visual pigments to specific environmental conditions.

How might optogenetic applications benefit from catfish rhodopsin research?

Catfish rhodopsin research offers several promising avenues for advancing optogenetic applications:

  • Cold-adapted variants: The accelerated kinetics of high-altitude catfish rhodopsin could provide optogenetic tools that function efficiently at lower temperatures, expanding their utility in various experimental settings .

  • Enhanced kinetic properties: The natural variations in rhodopsin kinetics across catfish species offer templates for developing optogenetic tools with customized activation/deactivation rates.

  • Diffusion dynamics engineering: Understanding how rhodopsin clustering affects signaling efficiency could inform the design of optogenetic tools with optimized membrane distribution and signaling properties .

To leverage these potential benefits, researchers should focus on:

  • Creating chimeric proteins incorporating specific domains from catfish rhodopsin

  • Systematic testing of kinetic properties across temperature ranges

  • Evaluating membrane distribution and clustering behavior of engineered variants

The evolutionary adaptations observed in catfish rhodopsin provide natural examples of how protein function can be modulated through specific mutations, offering valuable insights for protein engineering efforts in optogenetics .

What can computational modeling reveal about rhodopsin evolution?

Computational modeling approaches can provide significant insights into rhodopsin evolution:

  • Molecular dynamics simulations: These can reveal how specific amino acid substitutions affect protein flexibility, stability, and ligand interactions across evolutionary lineages.

  • Ancestral sequence reconstruction: By inferring ancestral rhodopsin sequences, researchers can trace the evolutionary trajectory of functional adaptations and test hypotheses about selective pressures.

  • Codon-based models of evolution: These help identify sites under positive selection, as demonstrated in studies of high-altitude catfish rhodopsin where parallel acceleration of evolutionary rates was observed .

  • Network analysis of coevolving residues: This approach can identify functionally coupled residues that evolve together to maintain or modify protein function.

Studies on catfish rhodopsin evolution demonstrate that functional convergence can occur through different molecular mechanisms, with parallel shifts in evolutionary rates but non-parallel specific substitutions across lineages . This suggests that computational approaches focusing solely on identical substitutions might miss important cases of functional convergence, highlighting the need for integrated structural-functional-evolutionary analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.