Recombinant Idiomarina loihiensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Organism and Genomic Context

Idiomarina loihiensis is a γ-proteobacterium isolated from hydrothermal vents at the Lōihi Seamount, Hawaii. Its genome (2.84 Mb) encodes 2,640 proteins, including ATP synthase subunits essential for energy metabolism . The atpB gene (UniProt ID: Q5QZI0) is part of the F₀ sector, which collaborates with subunit c (atpE) to enable proton-driven ATP synthesis .

Functional Role in ATP Synthase

Subunit a collaborates with subunit c (atpE) to form the proton channel in the F₀ sector. Key functions include:

  • Proton Translocation: Subunit a facilitates proton movement across the membrane, driving rotation of the c-ring (subunit c oligomer) to generate torque for ATP synthesis .

  • Structural Stability: Mutations or knockdowns in subunit a disrupt F₀ assembly, impairing ATP synthase activity and respiratory chain integrity .

Expression and Purification

  • Expression System: Optimized in E. coli for high yield (~1.0 mg/mL post-reconstitution) .

  • Purification: Affinity chromatography via His-tag, followed by lyophilization for long-term stability .

Research Applications

  • Antibody Production: Used to generate polyclonal antibodies for detecting ATP synthase in diverse species .

  • Drug Discovery: Subunit a is a target for bacterial ATP synthase inhibitors (e.g., tomatidine), highlighting its therapeutic potential .

  • Structural Studies: Critical for resolving ATP synthase mechanisms in extremophiles like I. loihiensis .

Table 2: Functional Conservation of ATP Synthase Subunit a

OrganismSubunit a FeaturesKey References
Idiomarina loihiensis265 residues, no targeting peptide, His-tagged
Zebrafish (Danio rerio)551 residues, antibacterial N-terminal domain
Human Mitochondria226 residues, requires targeting peptide

The N-terminal region of zebrafish ATP5A1 exhibits antibacterial activity, a feature absent in I. loihiensis atpB, underscoring evolutionary divergence .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; glycerol (50%) is recommended for aliquots .

  • Functional Studies: Further research is needed to elucidate interactions between atpB and other F₀ subunits in extremophilic environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
atpB; IL2625; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Target Names
atpB
Target Protein Sequence
MISGEQTPTQYIQHHLQNWTVGEGFWAVNVDTIFWSVLLGVLFLWSFRRVAKKSSAGVPG KWQCFVEMIVEFVDNSVKESFHGKDKLIAPLALTIFVWIFLMNLMDLIPVDWLPTAAMYG GYWLGFVEDPHDVYMKVVPTTDLNTTFALSLSVFALIIIYSIKYKGVKGFAKEMTFTPFN HWALIPVNFVLESITLLAKPASLALRLFGNMYAGELIFILIAMIGFWQLPAHFAWAVFHI LVITLQAFIFMMLTIVYLSMASSEH
Uniprot No.

Target Background

Function

Key component of the proton channel; it plays a crucial role in proton translocation across the membrane.

Database Links

KEGG: ilo:IL2625

STRING: 283942.IL2625

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Idiomarina loihiensis ATP synthase subunit a (atpB) and why is it studied?

Idiomarina loihiensis ATP synthase subunit a (atpB) is a membrane-bound component of the F-type ATP synthase complex in this deep-sea γ-proteobacterium. This protein has gained research interest because:

  • It forms part of the membrane domain (F₀) of ATP synthase, which is essential for proton translocation

  • I. loihiensis was isolated from a hydrothermal vent at 1,300-m depth on the Lōihi submarine volcano, Hawaii

  • Studying ATP synthase components from extremophiles provides insights into bioenergetic adaptations to extreme environments

The full-length protein consists of 265 amino acids and is encoded by the atpB gene (locus tag IL2625) . Recombinant expression allows detailed structural and functional studies of this protein.

What are the optimal protocols for expression and purification of recombinant I. loihiensis atpB?

Based on established protocols for ATP synthase subunits, including I. loihiensis atpB:

Expression Protocol:

  • Transform E. coli cells (preferably T7 Express lysY/Iq strain) with the appropriate expression vector containing the atpB gene

  • Grow transformed cells in LB medium at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Induce protein expression with IPTG (1.0 mM) and incubate for 30 minutes to 4 hours

  • Harvest cells by centrifugation at approximately 6,000 × g for 20 minutes

  • Store cell pellets at -80°C until purification

Purification Protocol:

  • Resuspend cells in lysis buffer (20 mM Tris-HCl pH 8.0) with protease inhibitors

  • Add lysozyme (1 mg/mL) and incubate at 4°C for 1.5 hours

  • Disrupt cells by sonication (50-75 W)

  • Centrifuge to separate insoluble fraction (containing membrane proteins)

  • Solubilize membrane fraction with appropriate detergent

  • Purify using affinity chromatography (Ni-NTA for His-tagged protein)

  • Further purify by size exclusion chromatography if needed

The recombinant protein typically achieves >90% purity as determined by SDS-PAGE .

How should recombinant I. loihiensis atpB be stored to maintain stability and activity?

Storage conditions significantly impact protein stability. For recombinant I. loihiensis atpB:

  • Short-term storage (up to one week):

    • Store working aliquots at 4°C

    • Avoid repeated freeze-thaw cycles, which can cause protein degradation

  • Long-term storage:

    • Store at -20°C/-80°C

    • Lyophilized form has extended shelf life (12 months at -20°C/-80°C) compared to liquid form (6 months)

    • Aliquoting is necessary for multiple use to avoid freeze-thaw cycles

  • Recommended storage buffer:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Addition of 50% glycerol is recommended for long-term storage

  • Reconstitution procedure:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

What analytical methods can be used to assess the quality of purified recombinant atpB?

Several complementary analytical techniques can verify the identity, purity, and integrity of recombinant atpB:

Analytical MethodPurposeKey Parameters
SDS-PAGEPurity assessment>90% purity standard for research applications
Western blottingIdentity confirmationUse anti-His tag or anti-atpB antibodies
Mass spectrometryMolecular weight verification, PTM analysisExpected MW: ~29 kDa plus tag
Circular dichroismSecondary structure assessmentConfirm alpha-helical structure typical of membrane proteins
Dynamic light scatteringAggregation assessmentMonodisperse preparation indicates proper folding
Functional assaysActivity assessmentATP hydrolysis/synthesis assays with reconstituted complex

Additionally, for membrane proteins like atpB, detergent screening may be necessary to identify conditions that maintain the native protein fold.

How can recombinant atpB be incorporated into functional ATP synthase complexes for mechanistic studies?

Reconstituting functional ATP synthase complexes with recombinant subunits presents significant challenges but enables detailed mechanistic studies:

Methodological Approach:

  • Co-expression strategy:

    • Design a polycistronic expression system for multiple ATP synthase subunits

    • Express in E. coli strains lacking endogenous ATP synthase genes to prevent contamination

  • Purification of individual subunits followed by reconstitution:

    • Purify individual subunits (α, β, γ, δ, ε, a, b, c) with compatible tags

    • Reconstitute the F₁ complex (α₃:β₃:γ:δ:ε) in vitro

    • Reconstitute the F₀ complex (a:b₂:c₁₀) separately

    • Combine F₁ and F₀ complexes to form the complete ATP synthase

  • Functional verification:

    • Measure ATP synthesis activity in reconstituted proteoliposomes under proton gradient

    • Assess ATP hydrolysis activity and its coupling to proton translocation

Recent research has shown successful reconstitution of bacterial ATP synthase complexes with ATPase activity. For A. baumannii F₁-ATPase, researchers generated recombinant complex composed of subunits α₃:β₃:γ:ε with demonstrable ATP hydrolysis activity .

What structural and functional features distinguish I. loihiensis atpB from other bacterial ATP synthase subunits?

Comparative analysis reveals several distinctive features of I. loihiensis atpB:

  • Sequence conservation analysis:

    • While the general structure is conserved, I. loihiensis atpB shows adaptations consistent with its deep-sea habitat

    • Hydrophobicity analysis reveals strong membrane-spanning regions typical of F₀ subunits

  • Functional implications:

    • The membrane domain of ATP synthase in extremophiles often shows adaptations for functioning under high pressure and variable pH

    • I. loihiensis relies primarily on amino acid catabolism rather than sugar fermentation for carbon and energy , which may influence ATP synthase regulation

  • Regulatory mechanisms:

    • Bacterial ATP synthases often possess unique regulatory elements (e.g., ε subunit in A. baumannii is the major regulator of latent ATP hydrolysis)

    • Understanding how I. loihiensis regulates ATP synthesis/hydrolysis balance in extreme environments could provide insights into bioenergetic adaptations

How can site-directed mutagenesis of recombinant atpB help elucidate proton translocation mechanisms?

Site-directed mutagenesis of atpB combined with functional assays provides powerful insights into ATP synthase mechanisms:

Key experimental approaches:

  • Critical residue identification:

    • Target conserved residues in transmembrane regions involved in proton channel formation

    • Focus on charged residues (Arg, Glu, Asp) that typically participate in proton translocation

  • Mutagenesis strategies:

    • Generate single point mutations to neutral amino acids (Ala, Leu)

    • Create charge-reversal mutations to assess electrostatic contributions

    • Design mutations that alter side-chain length while preserving charge

  • Functional assessment:

    • Reconstitute ATP synthase complexes with mutant atpB

    • Measure proton translocation using pH-sensitive fluorescent probes

    • Determine ATP synthesis/hydrolysis rates to assess coupling efficiency

  • Structural confirmation:

    • Use cryoEM approaches to visualize structural changes induced by mutations

    • Recent advances in cryoEM have enabled visualization of ATP synthase at up to 4.2 Å resolution in situ

Similar approaches with A. baumannii F₁-ATPase have identified residues critical for ATP hydrolysis regulation through mutational studies of single amino acid substitutions .

Research Challenges and Future Directions

Research on I. loihiensis atpB has several potential impacts on our understanding of biological energy systems:

  • Adaptation to extreme environments:

    • I. loihiensis was isolated from deep-sea hydrothermal vents (1,300-m depth)

    • ATP synthase adaptations may reveal mechanisms for maintaining energy homeostasis under high pressure and variable temperatures

  • Comparative bioenergetics:

    • Comparing ATP synthase components across species helps elucidate evolutionary adaptations in energy conservation mechanisms

    • I. loihiensis relies primarily on amino acid catabolism rather than sugar fermentation , which may influence ATP synthase regulation

  • Applications in synthetic biology:

    • ATP synthase components from extremophiles may have desirable properties for engineering robust bioenergetic systems

    • Understanding subunit interactions could enable design of modified ATP synthases with altered proton:ATP ratios

  • Disease relevance:

    • Bacterial ATP synthases are potential antibiotic targets

    • Studies on mycobacterial F-ATP synthase have identified specific regions (α533-545) as targets for inhibitor development

    • Recent research identified ATP synthase subunit e (ATP5I) as a target of medicinal biguanides with implications for cancer treatment

What emerging technologies could advance the structural and functional characterization of recombinant ATP synthase components?

Several cutting-edge technologies hold promise for deeper insights into ATP synthase structure and function:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances have enabled visualization of ATP synthase at up to 4.2 Å resolution in situ

    • In situ tomography can reveal native arrangements of ATP synthase complexes in membranes

    • Subtomogram averaging can distinguish different rotary states of ATP synthase within mitochondria

  • Single-molecule techniques:

    • FRET-based approaches to monitor conformational changes during catalytic cycles

    • Optical or magnetic tweezers to study mechanical properties of ATP synthase rotation

    • High-speed AFM to visualize rotary motion in real-time

  • Mass spectrometry innovations:

    • Hydrogen-deuterium exchange mass spectrometry for probing dynamics

    • Crosslinking mass spectrometry to map interaction interfaces between subunits

    • Native mass spectrometry to characterize intact complexes

  • Computational approaches:

    • Molecular dynamics simulations to model proton translocation

    • Machine learning for predicting effects of mutations on structure and function

    • Systems biology approaches for understanding ATP synthase in the context of cellular energetics

Advanced methodologies like these could help resolve remaining questions about the assembly, regulation, and catalytic mechanism of ATP synthase across different species, including I. loihiensis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.